Recombinant Rat Tmem35 is a 167-amino-acid transmembrane protein (UniProt ID: Q6JAM9) expressed in heterologous systems such as E. coli or HEK293 cells . It is alternatively termed Novel Acetylcholine Receptor Chaperone (NACHO) due to its role in facilitating the assembly and trafficking of neuronal α7 nAChRs . Key synonyms include Tuf1 and Spinal cord expression protein 4 .
Amino Acid Sequence:
MASPRTITIVALSVALGLFFVFMGTIKLTPRLSKDAYSEMKRAYKSYVRALPLLKKMGIN SILLRKSIGALEVACGIVMTLVPGRPKDVANFFLLLLVLAVLFFHQLVGDPLKRYAHALV FGILLTCRLLIARKPEDRSSEKKALPESAEEQPSLYEKAPQGKVKVS .
Binds p75 neurotrophin receptor (p75 NTR) via a conserved motif, enabling neurite outgrowth modulation .
nAChR Chaperoning: Tmem35a (NACHO) is essential for α7 nAChR membrane localization. Tmem35a knockout (KO) mice exhibit complete loss of α7 activity, leading to thermal hyperalgesia and mechanical allodynia .
Pain Modulation: Intrathecal nicotine administration in tmem35a KO mice partially restores analgesia, suggesting residual nAChR activity .
Adrenal Zona Glomerulosa (ZG) Expansion: Sodium restriction upregulates Tmem35 (TUF1) in rat ZG, correlating with sympathetic neurite elongation and aldosterone synthase expression .
p75 NTR Binding: Competitive displacement by nerve growth factor (NGF) confirms Tmem35’s neurotrophic role .
Angiotensin II induces Tmem35 mRNA in adrenal cells, linking it to sodium homeostasis .
Differential expression of 72 genes in tmem35a KO spinal cords highlights its regulatory role in neuroinflammation .
Antibody Production: Used as a native antigen for generating antibodies against nAChRs .
Electrophysiology: Critical for studying α7 nAChR function in synaptic transmission .
Neurotrophic Studies: Investigated for p75 NTR-mediated neurite outgrowth in adrenal and spinal cord tissues .
Transmembrane protein 35 (Tmem35), also known as Novel Acetylcholine receptor Chaperone (NACHO), is a small neuronal-specific transmembrane protein that plays a critical role in modulating chemical signaling within the nervous system. The protein is evolutionarily conserved across humans, non-human primates, and rodents, suggesting fundamental biological importance. Its primary function is serving as a necessary chaperone for the functional expression of nicotinic acetylcholine receptors (nAChRs), particularly the homomeric α7 and the assembly of heteromeric α3, α4, and α6-containing nAChRs . This chaperoning function is essential for proper neurotransmission in several neural circuits.
Tmem35 expression demonstrates distinct regional patterns in the rat brain. High expression levels have been identified in both the ventromedial hypothalamus (VMH) and the limbic circuit of rodent brains . This localization pattern is particularly significant as these regions are associated with social behavior and reward processing, suggesting potential roles for Tmem35 in these functions. Different brain regions may exhibit variable expression patterns, with implications for region-specific functions of this protein in neural circuitry.
For comprehensive analysis of Tmem35 expression in rat neural tissues, a multi-modal approach is recommended:
RT-PCR Analysis: For tissue distribution studies, RNA extraction followed by reverse transcription and PCR amplification provides a reliable method to determine Tmem35 mRNA expression across different tissues and developmental stages.
In Situ Hybridization: This technique allows precise localization of Tmem35 mRNA within specific cell types. The visualization typically employs probes that bind to Tmem35 mRNA, with positive signals appearing as brown staining in the cytoplasm of expressing cells .
Immunohistochemistry: For protein-level detection, immunohistochemical processing for Tmem35-positive cells allows visualization of protein expression patterns across brain regions. This approach is particularly useful for comparing expression between sexes and across different experimental conditions .
Subcellular Localization: GFP-tagged fusion proteins can be employed to determine the subcellular localization of Tmem35. This approach involves constructing recombinant green fluorescence expression vectors (such as pEGFP-Tmem35) and transfecting them into appropriate cell lines .
For effective production of recombinant rat Tmem35, the following methodological approach is recommended:
Gene Cloning: Isolate the complete Tmem35 open reading frame (ORF) from rat tissue (preferably brain tissue given its neuronal expression).
Expression Vector Construction: Subclone the Tmem35 ORF into an appropriate expression vector with restriction sites. For example, using XhoI and EcoRI restriction sites similar to the approach used for TMEM225 :
Design forward primer with XhoI site (e.g., 5'-ATC TCG AGC AAT GAT GCG CAT TCC-3')
Design reverse primer with EcoRI site (e.g., 5'-ATG AAT TCA GTC ACA GAG CCC AGG-3')
Cell Culture and Transfection: Culture appropriate cells (HeLa or neuronal cell lines) in Dulbecco's modified Eagle's medium supplemented with 10% fetal bovine serum and 1% penicillin/streptomycin at 37°C in a 5% humidified CO₂ atmosphere. Transfect cells with the recombinant expression vector using an appropriate transfection reagent (such as Superfect Reagent) .
Protein Purification: Extract and purify the recombinant protein using affinity chromatography if a tag has been added to the construct.
Verification: Confirm expression and functionality through Western blotting and functional assays relevant to nAChR assembly.
Tmem35 knockout mouse models exhibit significant phenotypic alterations related to pain processing and sensation:
Thermal Hyperalgesia: Mice with tmem35a deletion show increased sensitivity to thermal stimuli, suggesting a role for Tmem35 in modulating heat pain thresholds .
Mechanical Allodynia: Knockout mice demonstrate enhanced pain responses to mechanical stimuli that would not normally provoke pain in wild-type animals .
Altered Response to Nicotinic Agonists: Intrathecal administration of nicotine and the α7-specific agonist PHA543613 produces analgesic responses to noxious heat and mechanical stimuli respectively in tmem35a knockout mice, suggesting residual expression of nicotinic receptors or potential off-target effects .
Neuroinflammatory Changes: Transcriptomic analysis of the spinal cord in tmem35a knockout mice reveals 72 differentially expressed genes compared to wild-type controls, with pathway analysis suggesting increased neuroinflammation as a potential contributing factor to the hyperalgesia phenotype .
These findings collectively indicate that neuronal α7 nAChR in the spinal cord, which requires Tmem35a for proper assembly, contributes significantly to heat nociception processing.
Tmem35, also known as NACHO, serves as a critical chaperone protein for nAChR assembly through several mechanisms:
Essential Role in Receptor Assembly: Tmem35a is both necessary and sufficient for the assembly of nicotinic acetylcholine receptors . Without this chaperone, proper receptor formation is compromised.
Specificity for Receptor Subtypes: Tmem35a is particularly important for the functional expression of homomeric α7 nAChRs and the assembly of heteromeric α3, α4, and α6-containing nAChRs .
Neuronal Specificity: As a neuronal-specific transmembrane protein, Tmem35a's role in nAChR assembly is confined to neuronal populations, distinguishing it from other more ubiquitous chaperone proteins .
Pain Modulation Through nAChR Function: The pain phenotypes observed in knockout models suggest that Tmem35a's role in nAChR assembly directly influences pain processing pathways, particularly through α7 nAChRs in the spinal cord .
This chaperone function represents a critical step in ensuring proper cholinergic neurotransmission, with implications for multiple neurological processes including pain perception, cognitive function, and reward processing.
To investigate molecular interactions between Tmem35 and nAChRs, researchers should consider these methodological approaches:
Co-immunoprecipitation (Co-IP): This technique can identify physical interactions between Tmem35 and nAChR subunits. By using antibodies against either Tmem35 or specific nAChR subunits, researchers can pull down protein complexes and analyze them to determine direct binding partners.
Fluorescence Resonance Energy Transfer (FRET): By tagging Tmem35 and nAChR subunits with appropriate fluorophores, researchers can detect proximity-based energy transfer as evidence of molecular interaction in living cells.
Bimolecular Fluorescence Complementation (BiFC): This approach involves splitting a fluorescent protein and fusing each half to potential interacting partners (Tmem35 and nAChR subunits). Reconstitution of fluorescence indicates protein-protein interaction.
Deletion Mutant Analysis: Creating deletion mutants of Tmem35, similar to the N-terminal 35 amino acids deletion approach used for TMEM225 , can help identify specific domains required for interaction with nAChR subunits.
Crosslinking Studies: Chemical crosslinking followed by mass spectrometry can identify specific amino acid residues involved in the interaction between Tmem35 and nAChR subunits.
These methodologies provide complementary approaches to characterize the molecular basis of Tmem35's chaperoning function for nAChRs.
Transcriptomic analysis represents a powerful approach for understanding the broader molecular consequences of Tmem35 deletion:
RNA-Seq Analysis Pipeline:
Extract high-quality RNA from relevant tissues (spinal cord, specific brain regions)
Perform RNA sequencing with appropriate depth (30-50 million reads per sample)
Map reads to reference genome
Quantify gene expression levels
Identify differentially expressed genes (DEGs) between wild-type and knockout samples
Pathway Analysis: As demonstrated in studies of tmem35a knockout mice, which identified 72 differentially expressed genes in the spinal cord, transcriptomic data should be mapped onto functional gene networks using knowledge-based databases such as Ingenuity Pathway Analysis .
Cell-Type Specificity Analysis: Given Tmem35's neuronal-specific expression, single-cell RNA-seq can provide insights into cell-type-specific transcriptional changes following Tmem35 deletion.
Temporal Analysis: Examining transcriptional changes at different developmental timepoints can reveal how Tmem35 deletion affects gene expression dynamically.
Integration with Functional Data: Correlating transcriptomic changes with behavioral or electrophysiological phenotypes can help identify causative molecular mechanisms underlying observed functional deficits.
This approach can reveal unexpected molecular pathways affected by Tmem35 dysfunction, such as the neuroinflammatory changes suggested in previous studies .
Rat Tmem35 shares significant structural and functional similarities with Tmem35 in other species, but with some notable distinctions:
These comparative aspects should be considered when translating findings from rat models to other species, particularly in the context of pain processing and nAChR function.
Ensuring the quality and functionality of recombinant rat Tmem35 requires rigorous quality control measures:
Sequence Verification: Confirm the complete nucleotide sequence of cloned Tmem35 to ensure no mutations were introduced during cloning.
Expression Verification: Verify protein expression using Western blotting with specific antibodies against Tmem35 or any epitope tags incorporated into the recombinant construct.
Subcellular Localization Control: Confirm proper subcellular localization of recombinant Tmem35 using fluorescence microscopy of tagged constructs, comparing to known endogenous localization patterns.
Functional Validation: Assess the functionality of recombinant Tmem35 by measuring its ability to promote nAChR assembly and function, potentially using electrophysiological measurements of nAChR currents.
Batch-to-Batch Consistency: Implement stringent quality control between different batches of recombinant protein to ensure experimental reproducibility.
Endotoxin Testing: For recombinant proteins intended for in vivo use, test for endotoxin contamination that could confound experimental results.
These measures are essential for ensuring that experimental outcomes genuinely reflect Tmem35 biology rather than artifacts of the recombinant expression system.
Based on current understanding of Tmem35 biology, several promising research directions emerge:
Detailed Structural Studies: Determining the three-dimensional structure of Tmem35 would provide insights into its mechanism of action in nAChR assembly.
Cell-Type Specific Functions: Investigating Tmem35 function in specific neuronal populations could reveal specialized roles in different neural circuits.
Sex Hormone Regulation: Further exploration of how gonadal hormones regulate Tmem35 expression could explain the observed sexual dimorphism and suggest sex-specific therapeutic approaches.
Pain Pathway Modulation: Given the pain phenotypes in knockout models, investigating how Tmem35-mediated nAChR assembly influences pain processing pathways could lead to novel analgesic strategies.
Therapeutic Targeting: Exploring whether enhancing Tmem35 function could improve cholinergic neurotransmission in conditions characterized by cholinergic deficits.
Development of Conditional and Cell-Type Specific Knockout Models: Creating more refined knockout models would allow precise dissection of Tmem35 function in specific neural circuits and developmental periods.
These directions represent important opportunities to advance understanding of Tmem35 biology and its potential clinical relevance.
To address potential contradictions in Tmem35 research findings, researchers should consider:
Standardized Expression Analysis: Using consistent methodologies for measuring Tmem35 expression, including standardized RT-PCR protocols, antibody validation, and consistent imaging parameters.
Age and Sex Considerations: Given the age-dependent expression patterns observed in some transmembrane proteins and the sexual dimorphism in Tmem35 expression , controlling for age and sex is crucial for reconciling apparently contradictory findings.
Genetic Background Effects: Controlling for genetic background in animal models is essential, as strain differences can significantly influence phenotypes associated with Tmem35 manipulation.
Comprehensive Phenotyping: Employing multiple behavioral assays and physiological measurements provides a more complete picture of Tmem35 function and can help reconcile seemingly contradictory functional attributions.
Transparency in Reporting Negative Results: Publication of well-designed studies with negative results is essential for building a complete understanding of Tmem35 function.
Meta-Analysis Approaches: Systematic review and meta-analysis of Tmem35 studies can help identify sources of variability and true biological effects across different experimental paradigms.