Recombinant Rat Transmembrane protein 35 (Tmem35)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Significance

Recombinant Rat Tmem35 is a 167-amino-acid transmembrane protein (UniProt ID: Q6JAM9) expressed in heterologous systems such as E. coli or HEK293 cells . It is alternatively termed Novel Acetylcholine Receptor Chaperone (NACHO) due to its role in facilitating the assembly and trafficking of neuronal α7 nAChRs . Key synonyms include Tuf1 and Spinal cord expression protein 4 .

Primary Structure

  • Amino Acid Sequence:
    MASPRTITIVALSVALGLFFVFMGTIKLTPRLSKDAYSEMKRAYKSYVRALPLLKKMGIN SILLRKSIGALEVACGIVMTLVPGRPKDVANFFLLLLVLAVLFFHQLVGDPLKRYAHALV FGILLTCRLLIARKPEDRSSEKKALPESAEEQPSLYEKAPQGKVKVS .

Recombinant Variants

PropertyVariant 1 ( )Variant 2 ( )
Expression SystemE. coliHEK293 cells
TagsN-terminal HisHis (Fc)-Avi
Purity>90% (SDS-PAGE)≥85% (SDS-PAGE)
Storage-20°C/-80°C (lyophilized)-20°C/-80°C (PBS buffer)
ApplicationsSDS-PAGE, antibody productionProtein interaction studies

Post-Translational Features

  • Binds p75 neurotrophin receptor (p75 NTR) via a conserved motif, enabling neurite outgrowth modulation .

  • Requires glycerol (5–50%) for long-term stability .

Role in Neuronal Function

  • nAChR Chaperoning: Tmem35a (NACHO) is essential for α7 nAChR membrane localization. Tmem35a knockout (KO) mice exhibit complete loss of α7 activity, leading to thermal hyperalgesia and mechanical allodynia .

  • Pain Modulation: Intrathecal nicotine administration in tmem35a KO mice partially restores analgesia, suggesting residual nAChR activity .

Endocrine Interactions

  • Adrenal Zona Glomerulosa (ZG) Expansion: Sodium restriction upregulates Tmem35 (TUF1) in rat ZG, correlating with sympathetic neurite elongation and aldosterone synthase expression .

  • p75 NTR Binding: Competitive displacement by nerve growth factor (NGF) confirms Tmem35’s neurotrophic role .

Transcriptional Regulation

  • Angiotensin II induces Tmem35 mRNA in adrenal cells, linking it to sodium homeostasis .

  • Differential expression of 72 genes in tmem35a KO spinal cords highlights its regulatory role in neuroinflammation .

Applications in Research

  • Antibody Production: Used as a native antigen for generating antibodies against nAChRs .

  • Electrophysiology: Critical for studying α7 nAChR function in synaptic transmission .

  • Neurotrophic Studies: Investigated for p75 NTR-mediated neurite outgrowth in adrenal and spinal cord tissues .

Future Directions

  • Therapeutic Targeting: Potential for treating neuropathic pain via α7 nAChR modulation .

  • Neurodegenerative Diseases: Explore Tmem35’s role in Alzheimer’s or Parkinson’s via p75 NTR pathways .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Tmem35a; Nacho; Tmem35; Tuf1; Novel acetylcholine receptor chaperone; Spinal cord expression protein 4; TMEM35 gene-derived unknown factor 1; Transmembrane protein 35A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-167
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Tmem35a
Target Protein Sequence
MASPRTITIVALSVALGLFFVFMGTIKLTPRLSKDAYSEMKRAYKSYVRALPLLKKMGIN SILLRKSIGALEVACGIVMTLVPGRPKDVANFFLLLLVLAVLFFHQLVGDPLKRYAHALV FGILLTCRLLIARKPEDRSSEKKALPESAEEQPSLYEKAPQGKVKVS
Uniprot No.

Target Background

Function
Recombinant Rat Transmembrane protein 35 (Tmem35) is a molecular chaperone crucial for the proper assembly and functional expression of nicotinic acetylcholine receptors (nAChRs) throughout the brain. It plays an essential role in the correct folding, assembly, function, and surface trafficking of α7 (CHRNA7), α4β2, α3β2, and α3β4 receptors. Tmem35 stably interacts with ribophorin-1 (RPN1) and ribophorin-2 (RPN2) (components of the oligosaccharyl transferase (OST) complex) and calnexin (CANX), both vital for its effects on CHRNA7 assembly and function. Furthermore, it facilitates the proper folding and assembly of α6β2 and α6β2β3 receptors, acting in early stages of nAChR subunit assembly. Finally, it promotes the expression of the α4(2):β2(3) stoichiometric form over the α4(3):β2(2) form.
Gene References Into Functions
  1. TMEM35/TUF1 is a candidate for modulating neurite outgrowth in the ZG after sodium depletion. PMID: 20685870
Database Links
Protein Families
DoxX family
Subcellular Location
Peroxisome membrane; Multi-pass membrane protein. Cytoplasmic vesicle. Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Present in adrenal zona glomerusa but not in adrenal medulla (at protein level). Expressed in the hippocampus (at protein level).

Q&A

What is rat Transmembrane protein 35 (Tmem35) and what are its primary functions in neuronal systems?

Transmembrane protein 35 (Tmem35), also known as Novel Acetylcholine receptor Chaperone (NACHO), is a small neuronal-specific transmembrane protein that plays a critical role in modulating chemical signaling within the nervous system. The protein is evolutionarily conserved across humans, non-human primates, and rodents, suggesting fundamental biological importance. Its primary function is serving as a necessary chaperone for the functional expression of nicotinic acetylcholine receptors (nAChRs), particularly the homomeric α7 and the assembly of heteromeric α3, α4, and α6-containing nAChRs . This chaperoning function is essential for proper neurotransmission in several neural circuits.

How does Tmem35 expression vary across different brain regions in rats?

Tmem35 expression demonstrates distinct regional patterns in the rat brain. High expression levels have been identified in both the ventromedial hypothalamus (VMH) and the limbic circuit of rodent brains . This localization pattern is particularly significant as these regions are associated with social behavior and reward processing, suggesting potential roles for Tmem35 in these functions. Different brain regions may exhibit variable expression patterns, with implications for region-specific functions of this protein in neural circuitry.

What are the recommended methods for detecting Tmem35 expression in rat neural tissues?

For comprehensive analysis of Tmem35 expression in rat neural tissues, a multi-modal approach is recommended:

  • RT-PCR Analysis: For tissue distribution studies, RNA extraction followed by reverse transcription and PCR amplification provides a reliable method to determine Tmem35 mRNA expression across different tissues and developmental stages.

  • In Situ Hybridization: This technique allows precise localization of Tmem35 mRNA within specific cell types. The visualization typically employs probes that bind to Tmem35 mRNA, with positive signals appearing as brown staining in the cytoplasm of expressing cells .

  • Immunohistochemistry: For protein-level detection, immunohistochemical processing for Tmem35-positive cells allows visualization of protein expression patterns across brain regions. This approach is particularly useful for comparing expression between sexes and across different experimental conditions .

  • Subcellular Localization: GFP-tagged fusion proteins can be employed to determine the subcellular localization of Tmem35. This approach involves constructing recombinant green fluorescence expression vectors (such as pEGFP-Tmem35) and transfecting them into appropriate cell lines .

How can researchers effectively generate recombinant rat Tmem35 protein for functional studies?

For effective production of recombinant rat Tmem35, the following methodological approach is recommended:

  • Gene Cloning: Isolate the complete Tmem35 open reading frame (ORF) from rat tissue (preferably brain tissue given its neuronal expression).

  • Expression Vector Construction: Subclone the Tmem35 ORF into an appropriate expression vector with restriction sites. For example, using XhoI and EcoRI restriction sites similar to the approach used for TMEM225 :

    • Design forward primer with XhoI site (e.g., 5'-ATC TCG AGC AAT GAT GCG CAT TCC-3')

    • Design reverse primer with EcoRI site (e.g., 5'-ATG AAT TCA GTC ACA GAG CCC AGG-3')

  • Cell Culture and Transfection: Culture appropriate cells (HeLa or neuronal cell lines) in Dulbecco's modified Eagle's medium supplemented with 10% fetal bovine serum and 1% penicillin/streptomycin at 37°C in a 5% humidified CO₂ atmosphere. Transfect cells with the recombinant expression vector using an appropriate transfection reagent (such as Superfect Reagent) .

  • Protein Purification: Extract and purify the recombinant protein using affinity chromatography if a tag has been added to the construct.

  • Verification: Confirm expression and functionality through Western blotting and functional assays relevant to nAChR assembly.

What are the phenotypic consequences of Tmem35 deletion in rodent models?

Tmem35 knockout mouse models exhibit significant phenotypic alterations related to pain processing and sensation:

  • Thermal Hyperalgesia: Mice with tmem35a deletion show increased sensitivity to thermal stimuli, suggesting a role for Tmem35 in modulating heat pain thresholds .

  • Mechanical Allodynia: Knockout mice demonstrate enhanced pain responses to mechanical stimuli that would not normally provoke pain in wild-type animals .

  • Altered Response to Nicotinic Agonists: Intrathecal administration of nicotine and the α7-specific agonist PHA543613 produces analgesic responses to noxious heat and mechanical stimuli respectively in tmem35a knockout mice, suggesting residual expression of nicotinic receptors or potential off-target effects .

  • Neuroinflammatory Changes: Transcriptomic analysis of the spinal cord in tmem35a knockout mice reveals 72 differentially expressed genes compared to wild-type controls, with pathway analysis suggesting increased neuroinflammation as a potential contributing factor to the hyperalgesia phenotype .

These findings collectively indicate that neuronal α7 nAChR in the spinal cord, which requires Tmem35a for proper assembly, contributes significantly to heat nociception processing.

How does Tmem35 contribute to nicotinic acetylcholine receptor (nAChR) assembly and function?

Tmem35, also known as NACHO, serves as a critical chaperone protein for nAChR assembly through several mechanisms:

  • Essential Role in Receptor Assembly: Tmem35a is both necessary and sufficient for the assembly of nicotinic acetylcholine receptors . Without this chaperone, proper receptor formation is compromised.

  • Specificity for Receptor Subtypes: Tmem35a is particularly important for the functional expression of homomeric α7 nAChRs and the assembly of heteromeric α3, α4, and α6-containing nAChRs .

  • Neuronal Specificity: As a neuronal-specific transmembrane protein, Tmem35a's role in nAChR assembly is confined to neuronal populations, distinguishing it from other more ubiquitous chaperone proteins .

  • Pain Modulation Through nAChR Function: The pain phenotypes observed in knockout models suggest that Tmem35a's role in nAChR assembly directly influences pain processing pathways, particularly through α7 nAChRs in the spinal cord .

This chaperone function represents a critical step in ensuring proper cholinergic neurotransmission, with implications for multiple neurological processes including pain perception, cognitive function, and reward processing.

What approaches can researchers use to investigate the molecular interactions between Tmem35 and nAChRs?

To investigate molecular interactions between Tmem35 and nAChRs, researchers should consider these methodological approaches:

  • Co-immunoprecipitation (Co-IP): This technique can identify physical interactions between Tmem35 and nAChR subunits. By using antibodies against either Tmem35 or specific nAChR subunits, researchers can pull down protein complexes and analyze them to determine direct binding partners.

  • Fluorescence Resonance Energy Transfer (FRET): By tagging Tmem35 and nAChR subunits with appropriate fluorophores, researchers can detect proximity-based energy transfer as evidence of molecular interaction in living cells.

  • Bimolecular Fluorescence Complementation (BiFC): This approach involves splitting a fluorescent protein and fusing each half to potential interacting partners (Tmem35 and nAChR subunits). Reconstitution of fluorescence indicates protein-protein interaction.

  • Deletion Mutant Analysis: Creating deletion mutants of Tmem35, similar to the N-terminal 35 amino acids deletion approach used for TMEM225 , can help identify specific domains required for interaction with nAChR subunits.

  • Crosslinking Studies: Chemical crosslinking followed by mass spectrometry can identify specific amino acid residues involved in the interaction between Tmem35 and nAChR subunits.

These methodologies provide complementary approaches to characterize the molecular basis of Tmem35's chaperoning function for nAChRs.

How can transcriptomics be applied to understand the downstream effects of Tmem35 deletion?

Transcriptomic analysis represents a powerful approach for understanding the broader molecular consequences of Tmem35 deletion:

  • RNA-Seq Analysis Pipeline:

    • Extract high-quality RNA from relevant tissues (spinal cord, specific brain regions)

    • Perform RNA sequencing with appropriate depth (30-50 million reads per sample)

    • Map reads to reference genome

    • Quantify gene expression levels

    • Identify differentially expressed genes (DEGs) between wild-type and knockout samples

  • Pathway Analysis: As demonstrated in studies of tmem35a knockout mice, which identified 72 differentially expressed genes in the spinal cord, transcriptomic data should be mapped onto functional gene networks using knowledge-based databases such as Ingenuity Pathway Analysis .

  • Cell-Type Specificity Analysis: Given Tmem35's neuronal-specific expression, single-cell RNA-seq can provide insights into cell-type-specific transcriptional changes following Tmem35 deletion.

  • Temporal Analysis: Examining transcriptional changes at different developmental timepoints can reveal how Tmem35 deletion affects gene expression dynamically.

  • Integration with Functional Data: Correlating transcriptomic changes with behavioral or electrophysiological phenotypes can help identify causative molecular mechanisms underlying observed functional deficits.

This approach can reveal unexpected molecular pathways affected by Tmem35 dysfunction, such as the neuroinflammatory changes suggested in previous studies .

How does rat Tmem35 compare structurally and functionally to Tmem35 in other species?

Rat Tmem35 shares significant structural and functional similarities with Tmem35 in other species, but with some notable distinctions:

These comparative aspects should be considered when translating findings from rat models to other species, particularly in the context of pain processing and nAChR function.

What quality control measures are essential when working with recombinant rat Tmem35?

Ensuring the quality and functionality of recombinant rat Tmem35 requires rigorous quality control measures:

  • Sequence Verification: Confirm the complete nucleotide sequence of cloned Tmem35 to ensure no mutations were introduced during cloning.

  • Expression Verification: Verify protein expression using Western blotting with specific antibodies against Tmem35 or any epitope tags incorporated into the recombinant construct.

  • Subcellular Localization Control: Confirm proper subcellular localization of recombinant Tmem35 using fluorescence microscopy of tagged constructs, comparing to known endogenous localization patterns.

  • Functional Validation: Assess the functionality of recombinant Tmem35 by measuring its ability to promote nAChR assembly and function, potentially using electrophysiological measurements of nAChR currents.

  • Batch-to-Batch Consistency: Implement stringent quality control between different batches of recombinant protein to ensure experimental reproducibility.

  • Endotoxin Testing: For recombinant proteins intended for in vivo use, test for endotoxin contamination that could confound experimental results.

These measures are essential for ensuring that experimental outcomes genuinely reflect Tmem35 biology rather than artifacts of the recombinant expression system.

What are the most promising future directions for Tmem35 research?

Based on current understanding of Tmem35 biology, several promising research directions emerge:

  • Detailed Structural Studies: Determining the three-dimensional structure of Tmem35 would provide insights into its mechanism of action in nAChR assembly.

  • Cell-Type Specific Functions: Investigating Tmem35 function in specific neuronal populations could reveal specialized roles in different neural circuits.

  • Sex Hormone Regulation: Further exploration of how gonadal hormones regulate Tmem35 expression could explain the observed sexual dimorphism and suggest sex-specific therapeutic approaches.

  • Pain Pathway Modulation: Given the pain phenotypes in knockout models, investigating how Tmem35-mediated nAChR assembly influences pain processing pathways could lead to novel analgesic strategies.

  • Therapeutic Targeting: Exploring whether enhancing Tmem35 function could improve cholinergic neurotransmission in conditions characterized by cholinergic deficits.

  • Development of Conditional and Cell-Type Specific Knockout Models: Creating more refined knockout models would allow precise dissection of Tmem35 function in specific neural circuits and developmental periods.

These directions represent important opportunities to advance understanding of Tmem35 biology and its potential clinical relevance.

How can contradictory findings in Tmem35 research be reconciled through improved experimental design?

To address potential contradictions in Tmem35 research findings, researchers should consider:

  • Standardized Expression Analysis: Using consistent methodologies for measuring Tmem35 expression, including standardized RT-PCR protocols, antibody validation, and consistent imaging parameters.

  • Age and Sex Considerations: Given the age-dependent expression patterns observed in some transmembrane proteins and the sexual dimorphism in Tmem35 expression , controlling for age and sex is crucial for reconciling apparently contradictory findings.

  • Genetic Background Effects: Controlling for genetic background in animal models is essential, as strain differences can significantly influence phenotypes associated with Tmem35 manipulation.

  • Comprehensive Phenotyping: Employing multiple behavioral assays and physiological measurements provides a more complete picture of Tmem35 function and can help reconcile seemingly contradictory functional attributions.

  • Transparency in Reporting Negative Results: Publication of well-designed studies with negative results is essential for building a complete understanding of Tmem35 function.

  • Meta-Analysis Approaches: Systematic review and meta-analysis of Tmem35 studies can help identify sources of variability and true biological effects across different experimental paradigms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.