Recombinant Rat Transmembrane protein 41B (Tmem41b)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format readily available in our inventory. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize the development of the specified tag.
Synonyms
Tmem41b; Transmembrane protein 41B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Tmem41b
Target Protein Sequence
MAKGRVAERSQTEMLHSTPAGDRAVGTQGSAAPGNKDHLKEKPCVEAGSARTSLLILVSI FSCAAFVMFLVYKNFPQLSEEERVNMKVPRDMDDAKALGKVLSKYKDTFYVQVLVAYFAT YIFLQTFAIPGSIFLSILSGFLYPFPLALFLVCLCSGLGASFCYMLSYLVGRPVVYKYLT EKAVKWSQQVERHREHLINYIIFLRITPFLPNWFINITSPVINVPLKVFFIGTFLGVAPP SFVAIKAGTTLYQLTTAGEAVSWNSVFILMILALLSILPAIFQKKLKQKFE
Uniprot No.

Target Background

Function
Transmembrane protein 41B (Tmem41b) is a phospholipid scramblase implicated in lipid homeostasis and membrane dynamics processes. It exhibits phospholipid scramblase activity toward cholesterol and phosphatidylserine, as well as phosphatidylethanolamine and phosphatidylcholine. Tmem41b plays a crucial role in autophagosome formation, participating in the early stages of autophagosome biogenesis at the endoplasmic reticulum (ER) membrane. It reequilibrates the leaflets of the ER as lipids are extracted by ATG2 (ATG2A or ATG2B) to facilitate autophagosome assembly. Beyond autophagy, Tmem41b is involved in other processes requiring phospholipid scramblase activity. It is essential for normal motor neuron development.
Database Links
Protein Families
TMEM41 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Endomembrane system.

Q&A

What is the basic structure and cellular localization of Tmem41b?

Tmem41b is a multispanning membrane protein localized in the endoplasmic reticulum (ER). It contains a conserved domain that is also found in vacuole membrane protein 1 (VMP1), yeast Tvp38, and the bacterial DedA family of putative half-transporters . The protein spans the ER membrane multiple times and forms complexes with other ER-resident proteins. To study its localization, researchers commonly employ immunofluorescence microscopy using antibodies against Tmem41b or by expressing tagged versions of the protein (such as TMEM41B-FLAG or TMEM41B-GFP) and co-staining with ER markers.

How does the structure of Tmem41b relate to its functional domains?

The structural analysis of Tmem41b reveals important functional domains that contribute to its diverse cellular roles. The protein shares structural similarities with VMP1, suggesting evolutionary conservation of function. To investigate structure-function relationships, researchers can employ site-directed mutagenesis of conserved residues followed by functional assays to determine which domains are critical for its various functions in autophagy, lipid mobilization, and calcium regulation . Deletion constructs can also be used to identify minimal functional domains required for interaction with binding partners like VMP1.

What are the most effective methods to purify recombinant Tmem41b for structural studies?

For structural studies of Tmem41b, researchers have successfully used sequential purification strategies. In one approach, TMEM41B-FLAG and VMP1-TEV-GFP-His were co-expressed in Sf9 insect cells and purified using TALON (Cobalt) metal affinity resin followed by anti-FLAG M2 affinity gel chromatography . The purified complex can be further analyzed by size-exclusion chromatography to assess homogeneity and complex formation. For membrane proteins like Tmem41b, detergent screening is critical to maintain protein stability and function throughout purification. Common detergents include DDM (n-dodecyl-β-D-maltopyranoside), LMNG (lauryl maltose neopentyl glycol), or digitonin.

What is the basic function of Tmem41b in the autophagy pathway?

Tmem41b functions as an essential component in the early stages of autophagosome formation. Knockout of TMEM41B blocks autophagy at an early step, causing accumulation of ATG proteins and small vesicles but preventing the formation of elongating autophagosome-like structures . This indicates that Tmem41b is required for the initial membrane remodeling events that precede autophagosome formation. The protein works in concert with VMP1, as evidenced by their physical interaction and similar knockout phenotypes. For studying the role of Tmem41b in autophagy, researchers can use autophagic flux reporters such as GFP-LC3-RFP to monitor autophagosome formation and maturation .

How does Tmem41b interact with VMP1 to regulate autophagy, and what methods best capture this interaction?

Tmem41b forms a complex with VMP1 both in vivo and in vitro, and this interaction appears to be essential for autophagy regulation . In vitro binding assays have demonstrated that these proteins directly interact, with band intensities suggesting that more than one Tmem41b molecule associates with each VMP1 molecule . To study this interaction, researchers can employ co-immunoprecipitation followed by mass spectrometry, as described in the literature . Additionally, size-exclusion chromatography can be used to analyze the stoichiometry of the complex. The functional significance of this interaction is highlighted by the observation that overexpression of VMP1 can restore autophagic flux in TMEM41B-knockout cells , suggesting that these proteins have partially redundant functions or that VMP1 can compensate for Tmem41b loss when overexpressed.

What are the methodological approaches to investigate Tmem41b's role in lipid mobilization during autophagy?

To investigate Tmem41b's role in lipid mobilization, researchers can employ various lipid analysis techniques. TMEM41B-knockout cells display accumulation of lipid droplets , suggesting a defect in lipid metabolism or mobilization. Methods to quantify this phenotype include:

  • Lipid droplet staining with BODIPY or Oil Red O followed by fluorescence microscopy and quantitative image analysis

  • Lipidomic analysis using mass spectrometry to identify specific lipid species affected by Tmem41b deletion

  • Metabolic labeling with radioactive or stable isotope-labeled fatty acids to track lipid flux

  • In vitro lipid transfer assays to assess whether Tmem41b directly facilitates lipid movement between membranes

These methods can help determine whether Tmem41b functions in lipid transport, membrane contact site formation, or regulation of lipid metabolic enzymes.

What evidence supports Tmem41b's function as an ER calcium release channel?

Recent research has identified Tmem41b as a novel type of concentration-dependent ER Ca²⁺ release channel . Evidence supporting this function includes:

  • TMEM41B-deficient cells display ER Ca²⁺ overload

  • This Ca²⁺ overload triggers downstream signaling events, including upregulation of IL-2 and IL-7 receptors in naïve T cells

  • The Ca²⁺ channel activity appears to be concentration-dependent, suggesting a regulated mechanism

To study this calcium channel function, researchers can use calcium imaging techniques with fluorescent indicators such as Fura-2 or genetically encoded calcium indicators (GECIs) targeted to specific cellular compartments. Electrophysiological approaches such as patch-clamp recordings of reconstituted Tmem41b in artificial lipid bilayers could provide direct evidence of channel activity and biophysical properties.

How can researchers quantitatively assess Tmem41b-mediated calcium flux in different experimental systems?

To quantitatively assess Tmem41b-mediated calcium flux, researchers can implement several complementary approaches:

  • Real-time calcium imaging using ratiometric dyes (Fura-2) or genetically encoded calcium indicators (GCaMP) with subcellular targeting sequences to distinguish ER, cytosolic, and mitochondrial calcium pools

  • ER calcium store measurements using thapsigargin-induced calcium release protocols, comparing wild-type and Tmem41b-deficient cells

  • Radioisotope (⁴⁵Ca²⁺) flux assays in reconstituted proteoliposomes containing purified Tmem41b

  • Patch-clamp electrophysiology of Tmem41b-containing membranes to characterize channel conductance, gating properties, and ion selectivity

These approaches should be performed in both heterologous expression systems (HEK293 cells) and endogenous contexts (primary cells from Tmem41b conditional knockout animals) to validate physiological relevance.

What is the relationship between Tmem41b's calcium regulation function and its role in autophagy?

To investigate this relationship, researchers can use genetic approaches (structure-function analysis with domain-specific mutants) to determine whether the same regions of Tmem41b mediate both functions. Pharmacological manipulation of calcium levels in TMEM41B-deficient cells can help determine whether normalizing calcium homeostasis rescues autophagy defects. Time-course experiments tracking calcium flux and autophagy markers after Tmem41b induction or repression could reveal whether one function precedes and potentially regulates the other.

How does Tmem41b regulate naïve T cell metabolism and quiescence?

Tmem41b plays a critical role in maintaining the metabolic quiescence of naïve T cells. TMEM41B-deficient naïve T cells exhibit:

  • Increased basal signaling of JAK-STAT, AKT-mTOR, and MAPK pathways

  • Upregulation of IL-2 and IL-7 receptors

  • Downregulation of transcription factors associated with T cell quiescence (Klf2, Klf6)

  • Enhanced metabolic activity despite remaining phenotypically naïve (CD62L⁺CD44⁻)

Metabolic assays have demonstrated significantly increased oxygen consumption rate (OCR) and extracellular acidification rate (EACR) in TMEM41B-deficient naïve T cells, indicating heightened oxidative phosphorylation and glycolysis. These cells also display increased mitochondrial mass, membrane potential, and reactive oxygen species production .

What methodologies are most effective for studying Tmem41b's impact on T cell activation thresholds?

To study how Tmem41b affects T cell activation thresholds, researchers can employ:

  • Dose-response experiments with varying concentrations of T cell receptor (TCR) stimuli (anti-CD3/CD28 antibodies or peptide-MHC complexes)

  • Flow cytometry to measure activation markers (CD69, CD25) and signaling pathway activation (phospho-flow for pERK, pSTAT5, pS6)

  • Live cell imaging to track calcium flux during T cell activation

  • In vivo models of T cell tolerance, such as the αCD3 antibody-induced T cell deletion assay

  • Single-cell RNA sequencing to identify gene expression changes associated with altered activation thresholds

These approaches have revealed that TMEM41B deficiency results in reduced CD5 expression, a key negative regulator of TCR signaling, leading to heightened responsiveness to antigen stimulation .

How do Tmem41b-deficient T cells respond differently to infection models, and what are the implications for immune regulation?

TMEM41B-deficient T cells demonstrate altered responses in infection models:

  • In LCMV Armstrong infection, Cd4CreTmem41bfl/fl mice show significantly elevated percentages of antigen-specific CD8 T cells during peak response

  • Ex vivo restimulation with viral peptides produces more IFNγ⁺ cells in Tmem41b-deficient mice

  • Similar enhanced responses are observed in bacterial infection models with Listeria monocytogenes-OVA

  • TMEM41B-deficient T cells display reduced tolerance in αCD3-induced T cell deletion assays

These findings suggest that Tmem41b functions as a metabolic checkpoint in T cells, with its deficiency creating a primed state characterized by metabolic activation but maintained immunological naivety. This state enables faster and stronger responses upon antigen encounter. The long-term implications for immune regulation include potential reduced tolerance and heightened immunity to infections, though longitudinal studies are needed to assess whether this leads to autoimmunity or immunopathology in chronic settings.

What evidence supports Tmem41b's role as a pan-flavivirus host factor?

TMEM41B has been identified as a critical host factor required for flavivirus infection. Knockout studies have demonstrated that TMEM41B is necessary for infection by multiple members of the Flaviviridae family, including:

  • Tick-borne encephalitis virus (TBEV) - both European and Far Eastern clades

  • Hemorrhagic fever viruses: Omsk hemorrhagic fever virus (OHFV), Kyasanur forest disease virus (KFDV), and Alkhurma hemorrhagic fever virus (AHFV)

  • Hepatitis C virus (HCV) in the hepacivirus genus

  • Bovine viral diarrhea virus (BVDV) in the pestivirus genus

This broad requirement across diverse members of Flaviviridae in multiple cellular contexts (including hepatocellular carcinoma cells and bovine MDBK cells) establishes TMEM41B as a pan-flavivirus host factor. The mechanism appears to be conserved across host species, suggesting an evolutionarily preserved virus-host interaction.

What methodological approaches best measure the impact of Tmem41b manipulation on viral infection?

To measure how Tmem41b manipulation affects viral infection, researchers can employ:

  • Viral infection assays in TMEM41B-knockout or -knockdown cells, quantifying viral replication by:

    • Plaque assays for infectious viral particle production

    • qRT-PCR for viral RNA quantification

    • Flow cytometry for viral antigen expression

    • Luciferase reporter viruses for high-throughput screening

  • Complementation experiments to confirm specificity:

    • Rescue experiments with wild-type TMEM41B re-expression

    • Structure-function analysis with Tmem41b mutants

  • Time-of-addition experiments with inducible TMEM41B systems to determine which stage of the viral life cycle requires this host factor

  • Interaction studies to identify viral components that engage with TMEM41B:

    • Co-immunoprecipitation of viral proteins with TMEM41B

    • Proximity labeling approaches (BioID, APEX) to identify interaction partners during infection

  • Imaging approaches to visualize TMEM41B redistribution during infection:

    • Live cell imaging with fluorescently tagged TMEM41B

    • Correlative light and electron microscopy to visualize TMEM41B in relation to viral replication complexes

How might Tmem41b's roles in autophagy and viral infection be mechanistically connected?

The dual function of Tmem41b in autophagy and viral infection suggests potential mechanistic connections that researchers can investigate:

  • Many flaviviruses utilize or manipulate autophagy machinery for replication. TMEM41B's role in early autophagosome formation might provide membrane sources or remodeling capabilities that viruses exploit for replication complex formation.

  • TMEM41B's function in lipid mobilization may be critical for the membrane rearrangements required for flavivirus replication complex assembly.

  • The ER localization of TMEM41B coincides with the primary site of flavivirus replication, suggesting physical proximity to viral replication factories.

  • Calcium signaling, another function of TMEM41B , may influence viral replication through direct effects on viral proteases or polymerases, or indirectly through host signaling pathways.

To investigate these connections, researchers can perform comparative studies with TMEM41B mutants specifically defective in either autophagy, calcium regulation, or lipid metabolism, then assess their ability to support viral replication. Additionally, time-course studies examining when TMEM41B is recruited to viral replication sites relative to autophagy proteins could provide insights into whether these processes are coordinated or competitive during infection.

What are the most reliable knockout models for studying Tmem41b function in different systems?

For studying Tmem41b function, researchers have successfully employed several knockout strategies:

  • Cell line models:

    • CRISPR-Cas9-mediated knockout in human cell lines (HeLa, HEK293)

    • CRISPR-Cas9-mediated knockout in hepatocellular carcinoma cells (Huh-7.5)

    • CRISPR-Cas9-mediated knockout in bovine MDBK cells

  • Animal models:

    • Conditional knockout mice using Cre-loxP system (Cd4CreTmem41bfl/fl) for T cell-specific deletion

    • Complete knockout models may be generated but could potentially show developmental effects if Tmem41b is essential for embryonic development

  • Verification methods:

    • Western blotting to confirm protein absence

    • Genomic sequencing to verify indel formation

    • Functional assays (autophagy flux, lipid droplet accumulation) to confirm phenotypes

Each model system offers advantages depending on the research question. Cell lines provide high-throughput screening capabilities, while conditional knockout mice allow tissue-specific analysis in physiological contexts.

What reporter systems best capture Tmem41b-dependent autophagy dynamics?

Several reporter systems effectively capture Tmem41b-dependent autophagy dynamics:

  • GFP-LC3-RFP tandem fluorescent reporter:

    • This system was successfully used in genome-wide CRISPR screens that identified TMEM41B

    • Allows distinction between autophagosome formation (yellow puncta) and maturation (red-only puncta)

    • Can be used in live-cell imaging or fixed cell analysis

  • Protease protection assays:

    • Assess whether LC3-II is protected from trypsin digestion (indicating sealed autophagosome formation)

    • TMEM41B KO cells show trypsin-sensitive LC3-II, suggesting incomplete autophagosome formation

  • ATG protein recruitment dynamics:

    • Fluorescently tagged early autophagy proteins (ULK1, WIPI2, ATG5)

    • TMEM41B KO causes accumulation of early ATG proteins at aberrant structures

  • Electron microscopy:

    • Can visualize accumulation of small vesicles rather than elongating autophagosome-like structures in TMEM41B KO cells

    • Provides ultrastructural details of membrane abnormalities

These complementary approaches provide a comprehensive view of how Tmem41b affects different stages of the autophagy process.

What are the current technical challenges in measuring Tmem41b-mediated calcium flux and potential solutions?

Measuring Tmem41b-mediated calcium flux presents several technical challenges with potential solutions:

Challenges:

  • Distinguishing ER calcium release from other calcium sources

  • Determining direct vs. indirect effects of Tmem41b on calcium homeostasis

  • Reconstituting functional Tmem41b channels in artificial systems

  • Temporal resolution of calcium signals in cellular contexts

Solutions:

  • Organelle-targeted calcium indicators:

    • ER-targeted GCaMP variants or FRET-based calcium sensors

    • Simultaneous multi-compartment calcium imaging with spectrally distinct indicators

  • Pharmacological dissection:

    • Using specific inhibitors of known calcium channels (IP3R, RyR) to isolate Tmem41b-specific contributions

    • Thapsigargin pre-treatment to deplete ER calcium stores followed by store-operated calcium entry measurement

  • Electrophysiological approaches:

    • Patch-clamp of isolated ER membranes or nuclear envelope

    • Reconstitution of purified Tmem41b in planar lipid bilayers

    • Controlled lipid composition to assess lipid dependence of channel activity

  • Genetic approaches:

    • Structure-function analysis with pore domain mutants

    • Optogenetic or chemogenetic control of Tmem41b activity to establish causality

    • CRISPR-mediated tagging of endogenous Tmem41b to avoid overexpression artifacts

How does Tmem41b function relate to disease pathophysiology?

Tmem41b's diverse functions suggest potential roles in multiple disease contexts:

  • Infectious diseases:

    • As a pan-flavivirus host factor, TMEM41B may influence susceptibility to flavivirus infections including tick-borne encephalitis, dengue, and hepatitis C

    • Genetic variants might explain differential susceptibility to these infections

  • Immune disorders:

    • TMEM41B regulates T cell quiescence and activation thresholds, potentially influencing autoimmunity and immunodeficiency

    • Cd4CreTmem41bfl/fl mice show reduced tolerance in T cell deletion assays, suggesting potential roles in autoimmune conditions

  • Metabolic disorders:

    • TMEM41B-deficient cells accumulate lipid droplets, indicating a role in lipid metabolism

    • This may have implications for conditions involving lipid dysregulation like hepatic steatosis

  • Neurodegenerative diseases:

    • Autophagy defects are implicated in neurodegenerative diseases

    • As an essential autophagy regulator, TMEM41B dysfunction could potentially contribute to protein aggregation disorders

Research into these connections is likely still emerging, with transgenic animal models and human genetic studies needed to establish definitive disease associations.

What are the potential therapeutic applications of targeting Tmem41b?

Based on its functions, several therapeutic applications for Tmem41b targeting might be considered:

  • Antiviral strategies:

    • Small molecule inhibitors of TMEM41B could potentially serve as broad-spectrum antiflaviviral drugs

    • The fact that TMEM41B is required for multiple flaviviruses makes it an attractive pan-flaviviral target

  • Immunomodulation:

    • Transient TMEM41B inhibition might enhance T cell responses for immunotherapy or vaccination

    • TMEM41B-deficient T cells show heightened responses to infections and reduced activation thresholds

  • Autophagy modulation:

    • In conditions where enhanced autophagy is beneficial (neurodegenerative diseases), TMEM41B activators might promote autophagosome formation

    • In conditions where autophagy drives pathology, TMEM41B inhibitors might attenuate excessive autophagy

  • Calcium signaling intervention:

    • Targeting TMEM41B's calcium channel function could provide novel ways to modulate ER calcium homeostasis

    • This might have applications in disorders involving calcium dysregulation

For drug development, high-throughput screens could identify small molecules that modulate TMEM41B function, with subsequent optimization for specificity and pharmacokinetic properties.

What methodological approaches are recommended for translating Tmem41b basic research to clinical applications?

Translating Tmem41b research to clinical applications requires systematic approaches:

  • Target validation:

    • Human genetic association studies linking TMEM41B variants to disease susceptibility

    • Tissue-specific conditional knockout models to assess safety and efficacy of Tmem41b modulation

    • Patient-derived cells and organoids to confirm relevance in human systems

  • Drug discovery pipeline:

    • Structure determination of Tmem41b to enable rational drug design

    • High-throughput screening assays (based on calcium flux, autophagy reporters, or viral infection)

    • Medicinal chemistry optimization of lead compounds

    • ADME-Tox profiling (absorption, distribution, metabolism, excretion, toxicity)

  • Biomarker development:

    • Identify readouts of Tmem41b activity that could serve as pharmacodynamic markers

    • These might include specific lipid species, calcium signaling patterns, or autophagy markers

  • Therapeutic window assessment:

    • Determine whether partial vs. complete inhibition of Tmem41b is required for therapeutic effects

    • Assess potential side effects based on known Tmem41b functions in autophagy, calcium regulation, and T cell biology

    • Develop tissue-targeted delivery strategies if systemic effects prove problematic

This translational pathway would require multidisciplinary collaboration between basic scientists, medicinal chemists, pharmacologists, and clinicians to move from target identification to clinical development.

How can researchers address contradictory findings in Tmem41b functional studies?

When encountering contradictory findings in Tmem41b research, consider these methodological approaches:

  • Direct comparison of experimental systems:

    • Different cell types may express different levels of compensatory proteins (e.g., VMP1)

    • Knockout approaches may have different efficiencies or off-target effects

    • Culture conditions may affect cellular dependence on specific pathways

  • Temporal analysis:

    • Acute vs. chronic loss of Tmem41b may lead to different phenotypes due to compensatory mechanisms

    • Time-course experiments can reveal primary vs. secondary effects

  • Quantitative assessment:

    • Partial vs. complete loss of function may explain phenotypic differences

    • Quantitative proteomics of Tmem41b and interacting partners across experimental systems

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.