Recombinant Rat Transmembrane protein 55A (Tmem55a)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Pip4p2; Tmem55a; Type 2 phosphatidylinositol 4,5-bisphosphate 4-phosphatase; Type 2 PtdIns-4,5-P2 4-Ptase; PtdIns-4,5-P2 4-Ptase II; Transmembrane protein 55A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-257
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MAADGVDERSPLLSASHSGNVTPTAPPYLQESSPRAELPPPYTAIASPGTSGIPVINCRV CQSLINLDGKLHQHVVKCTVCNEATPIKTPPTGKKYVRCPCNCLLICKDTSRRIGCPRPN CRRIINLGPIMLISEEQPAQPALPVQPEGTRVVCGHCGNTFLWMELRFNTLAKCPHCKKI SSVGSALPRRRCCAYVTIGMICIFIGVGLTVGTQDFSRRFHATYVSWAIAYLLGLICLIR ACYWGAIRVSYPEHGFA
Uniprot No.

Target Background

Function
This recombinant rat transmembrane protein 55A (Tmem55a) catalyzes the hydrolysis of phosphatidylinositol-4,5-bisphosphate (PtdIns-4,5-P2) to phosphatidylinositol-4-phosphate (PtdIns-4-P). It does not hydrolyze phosphatidylinositol 3,4,5-trisphosphate, phosphatidylinositol 3,4-bisphosphate, inositol 3,5-bisphosphate, inositol 3,4-bisphosphate, phosphatidylinositol 5-monophosphate, phosphatidylinositol 4-monophosphate, or phosphatidylinositol 3-monophosphate. Furthermore, Tmem55a negatively regulates phagocytosis of large particles by reducing phagosomal phosphatidylinositol 4,5-bisphosphate accumulation during cup formation.
Database Links
Subcellular Location
Late endosome membrane; Multi-pass membrane protein. Lysosome membrane; Multi-pass membrane protein. Cytoplasmic vesicle, phagosome membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.

Q&A

What is Rat Transmembrane protein 55A (Tmem55a) and what is its primary function?

Rat Transmembrane protein 55A (Tmem55a) is a lipid phosphatase that catalyzes the hydrolysis of phosphatidylinositol-4,5-bisphosphate (PIP2) to phosphatidylinositol-5-phosphate (PI5P). This protein selectively removes the 4-position phosphate from PIP2, showing specificity for this substrate over other phosphoinositides. Tmem55a is expressed throughout the body, including in the pancreas, where it plays a significant role in cellular signaling pathways that regulate α-cell exocytosis and glucagon secretion .

How does the gene structure and expression pattern of rat Tmem55a appear in different tissues?

Rat Tmem55a is encoded by the gene officially known as PIP4P2, but also referred to by the synonym RGD1306225. The open reading frame (ORF) consists of 774 base pairs, with BC097492 as its reference sequence. Expression studies have shown that Tmem55a is expressed throughout multiple body tissues, with notable expression in the pancreas. Within pancreatic tissue, single-cell RNA sequencing analysis has revealed that PIP4P2 expression positively correlates with α-cell glucagon exocytosis, while being negatively correlated with β-cell insulin exocytosis, suggesting cell-type specific functions within the pancreatic islets .

What distinguishes Tmem55a from its homolog Tmem55b in terms of function?

While both Tmem55a and Tmem55b can catalyze the conversion of PIP2 to PI5P, they have distinct cellular functions. Tmem55a primarily regulates α-cell exocytosis and glucagon secretion in pancreatic islet cells. In contrast, Tmem55b contributes to cellular homeostasis through multiple mechanisms: (1) mediating NEDD4-dependent PLEKHM1 ubiquitination to halt autophagosome/lysosome fusion, (2) promoting recruitment of ESCRT machinery to lysosomal membranes for repair, and (3) sequestering the FLCN/FNIP complex to facilitate nuclear translocation of the transcription factor TFE3. These differences indicate that despite similar enzymatic activities, these proteins function in distinct cellular contexts and signaling pathways .

What are the optimal expression systems for producing functional recombinant rat Tmem55a?

For producing functional recombinant rat Tmem55a, mammalian expression systems are strongly preferred over bacterial systems. Research has demonstrated that full-length Tmem55a expressed in mammalian cells exhibits robust phosphatase activity, while the catalytic domain alone expressed in E. coli lacks detectable activity. This suggests that post-translational modifications and/or membrane association conferred in mammalian cells are essential for proper Tmem55a function. For viral-based expression, adeno-associated virus (AAV) vectors have proven effective, with options for various promoters (CMV being common for ubiquitous expression) and serotypes (AAV1, AAV2, AAV3, AAV5, AAV6, AAV8, AAV9, AAV-DJ) depending on target cell type. The vector can be designed with optional reporter genes (GFP, CFP, YFP, RFP, or mCherry) to facilitate expression tracking and cell identification .

How can researchers accurately measure Tmem55a phosphatase activity in experimental settings?

Measuring Tmem55a phosphatase activity requires careful consideration of the protein's native environment. An effective in vitro phosphatase assay protocol involves:

  • Expression of full-length Tmem55a in mammalian cells (e.g., HEK293)

  • Immunoprecipitation of the protein using specific antibodies

  • Performing the phosphatase assay on beads with the bound protein

  • Using PIP2 as the substrate and measuring PI5P production

  • Including appropriate controls, such as a loss-of-function mutant

The phosphatase activity can be quantified using techniques such as thin-layer chromatography, HPLC, or mass spectrometry to detect the conversion of PIP2 to PI5P. Live-cell imaging using PIP2-specific probes can also provide valuable data on the in situ function of Tmem55a under various experimental conditions .

What experimental design best demonstrates the relationship between Tmem55a activity and glucagon secretion?

To effectively demonstrate the relationship between Tmem55a activity and glucagon secretion, a comprehensive experimental approach should include:

  • Genetic manipulation: Compare glucagon secretion between control cells and cells with Tmem55a knockdown or overexpression

  • Rescue experiments: In Tmem55a-deficient cells, attempt to rescue the phenotype through direct introduction of PI5P

  • Glucose challenge tests: Measure glucagon secretion under varying glucose concentrations (low, normal, high)

  • Electrophysiological measurements: Use patch-clamp techniques to directly measure exocytosis

The key measurements should include:

  • Quantification of glucagon secretion using ELISA or RIA

  • Assessment of F-actin remodeling using fluorescent phalloidin staining

  • Evaluation of PI5P and PIP2 levels using mass spectrometry or specific probes

  • Analysis of RhoA activation status

This multi-faceted approach has successfully demonstrated that TMEM55A knockdown reduces α-cell exocytosis at low glucose, which can be rescued by direct reintroduction of PI5P, establishing a causal relationship between Tmem55a activity and glucagon secretion .

How does oxidative stress modulate Tmem55a activity and what are the implications for α-cell function?

Oxidative stress has been identified as an upstream regulator of Tmem55a activity in α-cells. Research has demonstrated that Tmem55a's phosphatase activity is enhanced in response to oxidative stress, such as exposure to H2O2. This activation leads to increased dephosphorylation of PIP2 to PI5P, which inhibits RhoA activation, promotes F-actin depolymerization, and ultimately facilitates glucagon exocytosis. The implications of this pathway for α-cell function are particularly significant in the context of diabetes, where oxidative stress is often elevated. This mechanism may represent a pathway through which oxidative stress contributes to dysregulated glucagon secretion in diabetic conditions .

The experimental approach to investigate this relationship includes:

  • Exposing α-cells to controlled oxidative stress while monitoring Tmem55a activity

  • Measuring PI5P production, RhoA activation, and F-actin remodeling

  • Assessing glucagon secretion under normal and oxidative stress conditions

  • Testing whether antioxidant treatments normalize this pathway

What is the molecular mechanism by which PI5P regulates RhoA activity in α-cells?

Mechanism ComponentObservation in α-cellsComparison with Other Cell Types
Pathway OverviewPI5P inhibits RhoA activationIn MEF cells, PI5P affects Rac1 and Cdc42, but not RhoA
Downstream EffectF-actin depolymerizationCell-type specific actin responses
Functional OutcomeEnhanced glucagon exocytosisVaries by cell type and function
Response to StressActivated by oxidative stressDifferent stress responses in other cells

The precise molecular mechanism by which PI5P inhibits RhoA in α-cells remains to be fully elucidated. Potential mechanisms include direct binding of PI5P to RhoA regulators (GEFs or GAPs), PI5P-dependent recruitment or activation of specific RhoA inhibitors, or indirect effects through PI5P-binding proteins. This cell-type specificity suggests that the PI5P-RhoA pathway involves additional factors or signaling components that are differentially expressed across cell types, making this an important area for future investigation .

How do post-translational modifications regulate Tmem55a activity in different cellular contexts?

Post-translational modifications likely play a crucial role in regulating Tmem55a activity, as evidenced by the observation that the protein exhibits robust phosphatase activity when expressed in mammalian cells but not when the catalytic domain alone is expressed in E. coli. This indicates that modifications occurring in mammalian cells are essential for Tmem55a function. Several types of modifications may regulate Tmem55a:

  • Phosphorylation: May activate or inhibit phosphatase activity

  • Ubiquitination: Could affect protein stability or localization

  • Oxidation: Given Tmem55a's response to oxidative stress, redox-sensitive modifications might directly regulate its activity

  • Membrane association: Proper localization appears critical for function

To investigate these modifications, researchers should employ mass spectrometry to identify and map modifications, conduct mutagenesis of potential modification sites, and compare the activity of modified versus unmodified protein. Understanding these regulatory mechanisms could provide insights into how Tmem55a activity is controlled in different cellular contexts and in response to various stimuli .

Can targeting the Tmem55a/PI5P/F-actin pathway provide therapeutic benefits in diabetes?

The Tmem55a/PI5P/F-actin pathway represents a potential therapeutic target for addressing α-cell dysfunction in diabetes. Based on the understanding that this pathway regulates glucagon secretion through F-actin remodeling, interventions that modulate this pathway might help normalize the dysregulated glucagon secretion observed in diabetic conditions.

Potential therapeutic approaches include:

  • Modulation of Tmem55a activity: Development of activators or inhibitors to adjust PI5P production

  • Direct targeting of PI5P levels: Delivery of PI5P or inhibition of its metabolism

  • Targeting downstream effectors: Modulating RhoA activity or directly targeting F-actin remodeling

  • Antioxidant approaches: Since oxidative stress activates this pathway, targeted antioxidant therapies might help normalize Tmem55a activity

The therapeutic potential would need to be evaluated in preclinical models first, assessing both efficacy in normalizing glucagon secretion and potential off-target effects, considering that these signaling molecules function in multiple cellular processes across different tissues .

What are the key considerations when designing AAV vectors for Tmem55a expression in specific pancreatic cell populations?

When designing AAV vectors for Tmem55a expression in pancreatic cell populations, researchers should consider:

  • Serotype selection: Different AAV serotypes have varying tropism for pancreatic cell types. AAV8 shows good pancreatic tropism, but the optimal serotype depends on the specific target (α-cells vs. β-cells) and species.

  • Promoter choice:

    • For α-cell-specific expression: glucagon promoter or Arx promoter elements

    • For β-cell-specific expression: insulin promoter or Pdx1 promoter elements

    • For pancreas-wide expression: Pdx1 promoter or CMV

  • Vector capacity: AAV has a limited packaging capacity (~4.7 kb), so the construct must accommodate the Tmem55a cDNA (774 bp), chosen promoter, regulatory elements, and any reporter genes.

  • Reporter gene inclusion: Options include using an IRES element for bicistronic expression, a 2A peptide sequence for co-translational cleavage, or a separate reporter under a different promoter.

  • Delivery method: Consider direct pancreatic injection, intraductal delivery, systemic delivery with pancreas-tropic serotypes, or timing of delivery for developmental studies .

What are the challenges in measuring PI5P levels in pancreatic α-cells and how can they be overcome?

Measuring PI5P levels in pancreatic α-cells presents several technical challenges:

ChallengeSolution
α-cell isolationUse FACS with α-cell-specific markers or laser capture microdissection
Low abundance of PI5PEmploy HPLC-coupled mass spectrometry or metabolic labeling with 3H-inositol
Discrimination from isomersImplement separation techniques to distinguish PI5P from PI4P
Dynamic changesDevelop real-time detection using specific PI5P probes for live-cell imaging
NormalizationInclude internal standards and normalize to cell number or protein content

By combining these approaches, researchers can overcome the technical challenges associated with measuring PI5P in α-cells and obtain reliable data on how Tmem55a activity affects PI5P levels under different experimental conditions .

What control conditions are essential when studying Tmem55a effects on glucagon secretion?

When studying Tmem55a effects on glucagon secretion, appropriate controls are essential:

  • Genetic manipulation controls:

    • For knockdown: Use non-targeting siRNA/shRNA with similar chemical properties

    • For overexpression: Include empty vector controls and catalytically inactive Tmem55a mutant

    • For CRISPR-Cas9: Include non-targeting guide RNAs and generate isogenic control lines

  • Rescue experiment controls:

    • When adding PI5P, include treatments with other phosphoinositides (PI4P, PI3P) to confirm specificity

    • Include proper vehicle controls for lipid delivery

  • Physiological condition controls:

    • Test multiple glucose concentrations (low, normal, high)

    • Include positive controls for glucagon secretion (arginine, adrenaline)

    • Test in the presence and absence of other islet hormones to account for paracrine effects

  • Experimental timing controls:

    • Establish appropriate time courses to distinguish immediate versus adaptive responses

    • For chronic manipulations, monitor potential compensatory changes

  • Cellular context controls:

    • Test in multiple models (cell lines, primary cells, isolated islets, in vivo)

    • Compare effects in α-cells from different sources to establish conservation of mechanisms

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.