Recombinant Rat Transmembrane protein 55B (Tmem55b)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Rat Transmembrane Protein 55B (Tmem55b)

Recombinant Rat Transmembrane protein 55B, or Tmem55b, is a protein that, in rats (Rattus norvegicus), is encoded by the gene Tmem55b . TMEM55B is involved in multiple cellular processes, including cholesterol metabolism, lysosomal function, and autophagy . It is also known as Type I phosphatidylinositol 4,5-bisphosphate 4-phosphatase (PtdIns-4,5-P2 4-Ptase I) .

Basic Information

CharacteristicDescription
NameTransmembrane protein 55B
Alternative Name(s)PtdIns-4,5-P2 4-Ptase I, Type I phosphatidylinositol 4,5-bisphosphate 4-phosphatase
SpeciesRattus norvegicus (Rat)
Uniprot IDQ5PPM8
Gene NameTmem55b
Expression Region1-284
AA SequenceMAADGERSPLLSEAGDGGAGGNGLAGPGGSATGPGGGLTPSAPPYGAGKHAPPQAFPPFPEGHPAVLPGEDPPPYSPLTSPDSGSAPMITCRVCQSPINVEGKMHQHVVKCGVCNEATPIKNAPPGKKYVRCPCNCLLICKVTSQRIACPRPYCKRIINLGPVHPGPLSPEPQPMGVRVICGHCKNTFLWTEFTDRTLARCPHCRKVSSIGRRYPRKRCICCFLLGLLLAVTATGLAFGTWKPAQQYGGIYAAWAFVILLAVLCLGRALYWGCMKVSHPVQNFS

Role in Cholesterol Metabolism

TMEM55B regulates plasma cholesterol levels by influencing LDLR (Low-Density Lipoprotein Receptor) lysosomal degradation, which is mediated by PI(4,5)P2 . Specifically, knockdown of Tmem55b in mice livers leads to increased plasma non-HDL cholesterol levels .

  • Tmem55b knockdown increases ApoE-containing lipoproteins .

  • TMEM55B regulates plasma lipids through LDLR .

  • TMEM55B regulates LDLR activity through PI(4,5)P2 .

Interaction with Tex2

TMEM55B interacts with Tex2, a tubular ER protein, at ER-LE/lys (endoplasmic reticulum–late endosome/lysosome) membrane contact sites (MCSs) . TMEM55 recruits Tex2 to these MCSs, which are essential for lysosomal functions .

Lysosomal Function and Autophagy

  • Lysosomal Homeostasis: TMEM55B contributes to lysosomal homeostasis and amino acid metabolism, which suggests it plays a role in the assembly of the V-ATPase complex in lipid rafts of the lysosomal membrane and subsequent activation of mTORC .

  • Autophagy Flux: TMEM55B functions as a molecular sensor that coordinates autophagosome degradation, lysosomal repair, and activation of stress responses .

  • Lysosomal Positioning: TMEM55B modulates lysosomal positioning, with its overexpression causing lysosomes to collapse into the cell center, while its depletion results in dispersion .

  • Lipid Metabolism: TMEM55B deficiency enhances lipophagy, which leads to increased fatty acid release from lysosomes to mitochondria but impairs mitophagy .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Pip4p1; Tmem55b; Type 1 phosphatidylinositol 4,5-bisphosphate 4-phosphatase; Type 1 PtdIns-4,5-P2 4-Ptase; PtdIns-4,5-P2 4-Ptase I; Transmembrane protein 55B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-284
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MAADGERSPLLSEAGDGGAGGNGLAGPGGSATGPGGGLTPSAPPYGAGKHAPPQAFPPFP EGHPAVLPGEDPPPYSPLTSPDSGSAPMITCRVCQSPINVEGKMHQHVVKCGVCNEATPI KNAPPGKKYVRCPCNCLLICKVTSQRIACPRPYCKRIINLGPVHPGPLSPEPQPMGVRVI CGHCKNTFLWTEFTDRTLARCPHCRKVSSIGRRYPRKRCICCFLLGLLLAVTATGLAFGT WKPAQQYGGIYAAWAFVILLAVLCLGRALYWGCMKVSHPVQNFS
Uniprot No.

Target Background

Function
Recombinant Rat Transmembrane protein 55B (Tmem55b) catalyzes the hydrolysis of phosphatidylinositol-4,5-bisphosphate (PtdIns-4,5-P2) to phosphatidylinositol-4-phosphate (PtdIns-4-P). It does not hydrolyze phosphatidylinositol 3,4,5-trisphosphate, phosphatidylinositol 3,4-bisphosphate, inositol 3,5-bisphosphate, inositol 3,4-bisphosphate, phosphatidylinositol 5-monophosphate, phosphatidylinositol 4-monophosphate, or phosphatidylinositol 3-monophosphate. Tmem55b regulates lysosomal positioning by recruiting JIP4 to lysosomal membranes, inducing retrograde transport of lysosomes along microtubules. It contributes to the assembly of the V-ATPase complex in lysosomal membrane lipid rafts and subsequent amino acid-dependent activation of mTORC1. Tmem55b may also play a role in regulating cellular cholesterol metabolism.
Database Links
Subcellular Location
Late endosome membrane; Multi-pass membrane protein. Lysosome membrane; Multi-pass membrane protein. Cytoplasmic vesicle, phagosome membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.