Recombinant Rat Transmembrane protein C16orf54 homolog

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting to -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. If a specific tag is required, please inform us, and we will prioritize its inclusion.
Synonyms
Transmembrane protein C16orf54 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-225
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Protein Sequence
MPATPQQPSGHTEGLTEPTSEAAMWVVIPCGPCIPIMLGLASLTAFFIITTAVLAERLFR RPQPDPSQRAPTLVWRPGGELWIEPTSSARERSEDWYGSSIPLLMDRAPDPPTPGGTLEG RATAPPAIPTPHPSPSSLVPQTPPEVPAQSTFWRPQTQEESPYATGLVSWVGPEPMAEAG LEVGSPRAWRLRQGSLEPDWSLQPRVTLEQISAFWKREGRTSVGF
Uniprot No.

Target Background

Database Links

KEGG: rno:308990

UniGene: Rn.98391

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

How does rat C16orf54 homolog compare to human C16orf54 in terms of sequence homology and function?

While the search results do not provide direct sequence alignment data between rat and human C16orf54, comparative analysis approaches would involve:

  • Sequence alignment using tools like BLAST or Clustal Omega

  • Analysis of conserved domains and structural motifs

  • Comparison of predicted secondary structures

  • Assessment of functional conservation

The human C16orf54 gene is associated with specific diseases including Spondylocostal Dysostosis 5 and Spondyloepimetaphyseal Dysplasia With Joint Laxity . Functional conservation studies between species would help determine if the rat homolog shares similar pathophysiological mechanisms.

What expression systems are optimal for producing recombinant rat C16orf54 homolog protein?

The recombinant rat C16orf54 homolog protein can be successfully expressed in E. coli expression systems, as demonstrated in commercially available products . For researchers establishing expression protocols:

  • E. coli-based expression:

    • Advantages: High yield, cost-effective, rapid production

    • Considerations: May lack post-translational modifications

    • Common strains: BL21(DE3), Rosetta, Origami

  • Mammalian expression systems:

    • Consider when post-translational modifications are critical

    • HEK293 or CHO cells may provide more native-like protein folding

  • Insect cell expression:

    • Baculovirus systems offer a compromise between bacterial and mammalian systems

    • Better for complex transmembrane proteins requiring proper folding

The choice depends on research objectives and downstream applications. Current evidence shows E. coli expression yields functionally viable protein with >90% purity as determined by SDS-PAGE .

What are the most effective methods for purifying recombinant rat C16orf54 homolog protein?

Based on the available commercial preparations, the following purification strategy is recommended:

  • Affinity chromatography:

    • His-tag purification using Ni-NTA or similar matrices

    • Consider imidazole gradient elution to reduce non-specific binding

  • Quality control assessments:

    • SDS-PAGE analysis under reducing and non-reducing conditions

    • Western blot confirmation using anti-His antibodies

    • Size exclusion chromatography for final polishing

  • Storage considerations:

    • Lyophilization in the presence of stabilizers like trehalose

    • Reconstitution in appropriate buffers (PBS recommended)

    • Aliquoting to avoid freeze-thaw cycles

Researchers should aim for purity >90% as assessed by SDS-PAGE for most functional studies .

How should researchers design functional assays to study rat C16orf54 homolog in immune cell infiltration models?

Based on the known association between C16orf54 and immune cell infiltration in human cancers , researchers should consider the following experimental design approaches:

  • In vitro migration assays:

    • Transwell migration systems with C16orf54-expressing cells

    • Co-culture systems with immune cells (T-cells, macrophages)

    • Chemotaxis quantification using fluorescent labeling

  • Expression modulation experiments:

    • siRNA knockdown or CRISPR-Cas9 deletion of C16orf54

    • Overexpression studies using lentiviral vectors

    • Dosage-dependent functional assessment

  • Interaction studies:

    • Co-immunoprecipitation to identify binding partners

    • Proximity ligation assays for in situ interaction detection

    • Yeast two-hybrid screening for novel interactors

  • Readout measurements:

    • Flow cytometry quantification of immune cell populations

    • Cytokine/chemokine profiling by ELISA or multiplex assays

    • RNA-seq for transcriptional consequences

These approaches should be adapted based on the specific hypothesis being tested regarding C16orf54's role in immune regulation .

What are the optimal storage and handling conditions for recombinant rat C16orf54 homolog protein to maintain stability?

To maintain optimal stability and functionality of the recombinant protein:

  • Storage recommendations:

    • Store lyophilized powder at -20°C/-80°C upon receipt

    • Avoid repeated freeze-thaw cycles by preparing working aliquots

    • Working aliquots can be stored at 4°C for up to one week

  • Reconstitution protocol:

    • Briefly centrifuge vial prior to opening

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add glycerol to 5-50% final concentration for long-term storage

    • Standard recommendation is 50% glycerol for optimal stability

  • Quality control during handling:

    • Verify protein integrity after reconstitution via SDS-PAGE

    • Monitor activity using functional assays specific to your research question

    • Document storage conditions and freeze-thaw history for reproducibility

Following these guidelines will help ensure consistent experimental results when working with this protein .

How does C16orf54 expression correlate with cancer prognosis, and how can this inform rat model design?

Human C16orf54 shows significant correlations with prognosis in various cancer types, which can inform rat model design:

Based on these patterns, researchers designing rat cancer models should:

  • Consider cancer type-specific expression patterns

  • Implement inducible expression systems to model both over and under-expression

  • Include appropriate immune system components to study infiltration

  • Incorporate longitudinal monitoring for survival outcomes

These data indicate that C16orf54's role may be context-dependent, functioning differently across cancer types, which should be considered in experimental design .

What methodological approaches are recommended for investigating C16orf54's role in tumor immune microenvironment using rat models?

Based on human cancer data showing C16orf54's association with immune cell infiltration, researchers should consider:

  • Syngeneic tumor models:

    • Implant C16orf54-modulated rat cancer cell lines into immunocompetent rats

    • Compare tumor growth and immune infiltration between wild-type and modified cells

    • Perform longitudinal monitoring of tumor progression

  • Flow cytometry panels for immune profiling:

    • T cell subsets (CD4+, CD8+, Tregs)

    • Myeloid populations (macrophages, MDSCs, dendritic cells)

    • Activation/exhaustion markers on immune cells

  • Spatial analysis techniques:

    • Multiplex immunohistochemistry for spatial relationships

    • Digital pathology quantification of immune infiltration patterns

    • Single-cell RNA sequencing of tumor microenvironment

  • Functional intervention studies:

    • Immune checkpoint blockade response in C16orf54-high vs. low tumors

    • Adoptive cell therapy efficacy correlation with C16orf54 expression

    • Combination approaches based on mechanistic findings

These approaches would help translate the human cancer findings into mechanistic understanding using rat models .

How can researchers design experiments to elucidate the mechanistic relationship between C16orf54 and tumor mutation burden (TMB) or microsatellite instability (MSI)?

The human data shows significant correlation between C16orf54 expression and tumor heterogeneity indicators like TMB and MSI . To investigate these relationships in rat models:

  • Genetic engineering approaches:

    • Generate C16orf54 knockout rat cancer cell lines using CRISPR-Cas9

    • Create C16orf54 overexpression models with stable transfection

    • Develop inducible expression systems for temporal control

  • Genomic instability assessment:

    • Whole-genome sequencing to quantify mutation rates

    • MSI analysis using standard marker panels adapted for rat genome

    • DNA repair pathway activity measurement (comet assay, γH2AX quantification)

  • Correlation analyses:

    • Measure C16orf54 expression levels and correlate with:

      • Mutation burden (mutations/megabase)

      • MSI scores

      • DNA damage response pathway activity

  • Causal relationship testing:

    • DNA damage induction in cells with varying C16orf54 levels

    • Measurement of repair efficiency in different C16orf54 expression contexts

    • Assessment of mutagenic response to specific DNA damaging agents

These experimental approaches would help establish whether the correlation observed in human cancers represents a causal relationship or co-occurrence phenomenon .

What are the recommended approaches for studying the interaction between C16orf54 and cancer stemness indicators?

Human cancer data indicates correlation between C16orf54 expression and tumor stemness indicators including DNAss and RNAss . To investigate this in experimental models:

  • Cancer stem cell (CSC) isolation and characterization:

    • Sphere formation assays with C16orf54-modified cells

    • Flow cytometry for established CSC markers

    • Limited dilution assays to assess tumorigenic potential

  • Gene expression profiling:

    • Quantify stemness-associated transcription factors (Oct4, Sox2, Nanog)

    • RNA-seq of C16orf54-high vs. low populations

    • Single-cell RNA-seq to identify stem-like subpopulations

  • Functional stem cell assays:

    • Self-renewal capacity in serial passage

    • Differentiation potential under various conditions

    • Drug resistance profiles compared to non-stem populations

  • Pathway analysis:

    • Evaluate Wnt, Notch, and Hedgehog pathway activation

    • Assess epithelial-mesenchymal transition markers

    • Investigate metabolic reprogramming associated with stemness

By systematically addressing these aspects, researchers can determine whether C16orf54 plays a regulatory role in cancer stem cell maintenance or if the correlation observed in human cancers represents a non-causal association .

What are common technical challenges in working with recombinant rat C16orf54 homolog protein, and how can they be addressed?

Researchers commonly encounter several challenges when working with transmembrane proteins like C16orf54:

  • Solubility issues:

    • Challenge: Aggregation during reconstitution

    • Solution: Use mild detergents (0.1% Triton X-100, CHAPS) or optimize buffer conditions

    • Assessment: Dynamic light scattering to monitor aggregation state

  • Activity loss during storage:

    • Challenge: Functional degradation despite apparent physical stability

    • Solution: Add stabilizers like trehalose or glycerol; store at appropriate temperature

    • Assessment: Regular functional assays to verify activity retention

  • Non-specific binding in assays:

    • Challenge: High background in binding studies

    • Solution: Include appropriate blocking agents; optimize washing conditions

    • Assessment: Include negative controls with irrelevant tagged proteins

  • Reconstitution inconsistency:

    • Challenge: Batch-to-batch variation in solubility or activity

    • Solution: Standardize reconstitution protocols with exact pH, ionic strength

    • Assessment: Implement quality control checks before experimental use

  • Transmembrane domain function:

    • Challenge: Maintaining native conformation of membrane-spanning regions

    • Solution: Consider including suitable lipids or amphipols during reconstitution

    • Assessment: Circular dichroism to verify secondary structure integrity

These technical considerations are critical for obtaining reliable and reproducible results when studying transmembrane proteins like C16orf54 .

How can researchers validate antibody specificity for rat C16orf54 homolog in experimental systems?

Rigorous antibody validation is essential for C16orf54 research. Recommended approaches include:

  • Western blot validation:

    • Use recombinant protein as positive control

    • Include knockout/knockdown samples as negative controls

    • Test for cross-reactivity with related proteins

    • Evaluate multiple antibodies targeting different epitopes

  • Immunofluorescence specificity:

    • Perform peptide competition assays

    • Compare localization patterns with tagged overexpression constructs

    • Evaluate subcellular distribution against predicted localization

  • Flow cytometry validation:

    • Titrate antibody for optimal signal-to-noise ratio

    • Compare staining between positive and negative cell populations

    • Use fluorescence-minus-one (FMO) controls

  • Immunoprecipitation performance:

    • Confirm pull-down of recombinant protein

    • Identify expected interaction partners

    • Evaluate background binding with pre-immune serum

  • Systematic documentation:

    • Record antibody clone, lot number, and vendor

    • Document validation experiments in detail

    • Share validation data with publications to enhance reproducibility

These validation steps ensure reliable detection of C16orf54 and help avoid misinterpretation of experimental results due to antibody artifacts.

What are promising research directions for elucidating the role of C16orf54 in immune regulation based on current knowledge?

Based on the association between C16orf54 and immune cell infiltration in human cancers , several promising research directions emerge:

  • Receptor-ligand interaction studies:

    • Identify potential binding partners using proximity labeling approaches

    • Characterize binding kinetics with surface plasmon resonance

    • Map interaction domains through mutational analysis

  • Signaling pathway investigation:

    • Phosphoproteomic analysis following C16orf54 activation/inhibition

    • Pathway inhibitor screens to identify downstream mediators

    • CRISPR screens for synthetic lethality with C16orf54 modulation

  • Immune checkpoint relationship:

    • Study co-expression patterns with established checkpoint molecules

    • Evaluate combination approaches with checkpoint inhibitors

    • Investigate potential synergies in immune activation/suppression

  • Translational biomarker development:

    • Develop robust detection methods for C16orf54 in biological samples

    • Correlate expression with treatment response in preclinical models

    • Establish cutoff values for high vs. low expression in prognostic applications

These research directions would address significant knowledge gaps and potentially reveal new therapeutic targets and biomarkers for immune-oncology applications .

How might CRISPR-Cas9 gene editing be optimally employed to study C16orf54 function in rat models?

CRISPR-Cas9 technology offers powerful approaches for studying C16orf54 function:

  • Knockout model generation:

    • Design multiple gRNAs targeting conserved exons

    • Screen for complete protein loss via Western blot

    • Validate phenotypes with rescue experiments

  • Domain-specific mutations:

    • Create point mutations in functional domains

    • Implement knock-in strategies for tagged versions

    • Develop conditional knockout models using loxP sites

  • High-throughput screening:

    • CRISPR libraries targeting genes in C16orf54-related pathways

    • Dropout screens to identify synthetic lethal interactions

    • Activation/repression screens using CRISPRa/CRISPRi

  • In vivo editing approaches:

    • Viral delivery of CRISPR components to specific tissues

    • Inducible CRISPR systems for temporal control

    • Somatic editing in adult animals for tissue-specific studies

These approaches would provide mechanistic insights beyond correlative observations, establishing causal relationships between C16orf54 and observed phenotypes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.