Recombinant Rat Transmembrane protein C9orf71 homolog

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline for your preparations.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
Tmem252; Transmembrane protein 252
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-185
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Tmem252
Target Protein Sequence
MQNRTGLVLCALSLLTGFLMICLGGFFISSSSSHSHRNLVVAYVLLPLGFVILLSGIFWG TYRQANDNKEMFNHVLRQHLAFQDLPLATVDRPDFYPPAYEESLDVEKQACSAGRGLLGF PPPLYTETSLEPQDKDKNDPQPEAPPPYPENIAVAAATVKTQDAEEPSTVLKAGAVLQLS ELASC
Uniprot No.

Target Background

Database Links

KEGG: rno:361744

UniGene: Rn.23870

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the rat homolog of human C9orf72 and how conserved is it?

The rat homolog of human C9orf72 is encoded by the gene RGD1359108. This gene shows remarkably high sequence conservation with the human C9ORF72 gene, with approximately 97.71% sequence identity . This high degree of conservation across species suggests that the protein encoded by C9orf72 serves fundamental biological functions that have been preserved throughout evolution. The conservation extends to other model organisms as well, including mouse (98.13%), rabbit (98.54%), and zebrafish (75.97%), making rat models valuable for studying C9orf72-related mechanisms .

What are the transcript variants and protein isoforms of rat C9orf72 homolog?

Similar to human C9orf72, which produces three transcript variants (V1, V2, and V3) resulting in two protein isoforms (C9-short and C9-long), the rat homolog also produces multiple transcripts . The shorter isoform (equivalent to human C9-short of 24 kDa) contains primarily the longin domain, while the longer isoform (equivalent to human C9-long of 54 kDa) contains the complete protein structure with longin, DENN, and C-terminal alpha domains . For experimental protocols, researchers should design PCR primers that can distinguish between these variants, typically targeting unique exon junctions (exon 1a or 1b with exon 2 for variant specificity) .

What are the main functional domains of rat C9orf72 homolog and how do they contribute to protein function?

The rat C9orf72 homolog contains three primary domains that contribute to its cellular functions: (1) the N-terminal longin domain (corresponding to aa 23-150 in humans), which is associated with endomembrane trafficking regulation and small GTPase binding; (2) the DENN domain (aa 212-312 in humans), which typically functions in GDP-GTP exchange; and (3) the C-terminal alpha domain (aa 313-481 in humans) . Together, these domains classify C9orf72 as a member of the DENN protein family, suggesting a role as a guanine nucleotide exchange factor (GEF) for Rab GTPases, which are crucial regulators of membrane trafficking . Experimental verification of these functional activities in the rat homolog can be accomplished through pull-down assays with recombinant Rab proteins and in vitro GEF activity assays monitoring GDP-GTP exchange rates.

How does rat C9orf72 homolog interact with translation initiation factors like eIF2α?

The rat C9orf72 homolog interacts with eukaryotic initiation factor 2 subunit alpha (eIF2α) and its phosphorylated form, as demonstrated through immunoprecipitation-mass spectrometry (IP-MS) assays . This interaction influences the stability of the eIF2-eIF2B complex, which is crucial for translation initiation. Methodologically, researchers can verify this interaction using co-immunoprecipitation experiments with tagged C9orf72 followed by western blotting for eIF2α. For functional assessment, measuring global translation rates using puromycin incorporation assays in cells with manipulated C9orf72 expression can provide insights into how this interaction affects protein synthesis.

What is the role of rat C9orf72 homolog in neuronal activity-dependent gene regulation?

Studies indicate that C9orf72 transcript levels respond to neuronal activity, specifically showing downregulation following prolonged membrane depolarization in neurons . This activity-dependent regulation appears to be specific to the late wave of activity-dependent transcription (approximately 6 hours post-stimulation) rather than the early wave (2 hours post-stimulation) . Researchers investigating this phenomenon should implement protocols using KCl-induced membrane depolarization (typically 55mM KCl) in primary rat cortical neurons, followed by time-course analyses of transcript variants using quantitative PCR with variant-specific primers .

What are optimal methods for studying rat C9orf72 homolog knockout effects in cellular and animal models?

For cellular models, CRISPR-Cas9 gene editing provides the most precise method for generating rat C9orf72 homolog knockout cell lines . Guide RNAs should target conserved exons (preferably exon 2 or 3) that are present in all transcript variants. For animal models, constitutive knockout rats have been successfully generated, although they develop splenomegaly with inflammation, suggesting immune system disruption . Researchers should consider:

  • Conditional knockout approaches using Cre-loxP systems for tissue-specific deletion

  • Time-controlled knockout using tamoxifen-inducible systems to bypass developmental effects

  • Comprehensive phenotyping including motor function, cognitive testing, and histopathological assessment

  • Regular monitoring of immune parameters given the inflammatory phenotype

For either cellular or animal models, validation of knockout should include both RNA (qPCR) and protein (western blot) analyses.

How should researchers design experiments to distinguish between loss-of-function and gain-of-function mechanisms?

To effectively differentiate between loss-of-function effects (due to C9orf72 haploinsufficiency) and gain-of-function effects (from toxic RNA or protein products), implement a multi-faceted experimental design:

  • Generate parallel models: (a) knockout/knockdown models (loss-of-function), (b) models expressing expanded hexanucleotide repeats (gain-of-function), and (c) rescue models where the protein is re-expressed in knockout backgrounds

  • Compare molecular phenotypes across these models, focusing on:

    • Stress granule dynamics using live-cell imaging with stress granule markers

    • Unfolded protein response activation by measuring expression of UPR markers (BiP, CHOP, XBP1 splicing)

    • Global translation rates using puromycin incorporation assays

    • Autophagy flux using LC3 conversion assays

  • Implement specific pathway inhibitors to validate mechanisms (e.g., ISRIB to inhibit integrated stress response)

This approach allows systematic isolation of phenotypes attributable specifically to loss of C9orf72 function versus those resulting from toxic products.

What are the critical controls needed when studying activity-dependent regulation of rat C9orf72 homolog?

When investigating the activity-dependent regulation of rat C9orf72 homolog, the following controls are critical:

  • Positive control genes: Include immediate early genes (IEGs) such as Fos and Arc that show robust induction following neuronal activation (2-5 fold increase at 2 hours post-stimulation)

  • Late response genes: Include genes known to respond in the late wave of transcription (~6 hours)

  • Activity blockade controls: Include samples treated with tetrodotoxin (TTX) and/or NMDA receptor antagonists to block spontaneous activity

  • Non-neuronal cell controls: Perform parallel experiments in glial cultures to confirm neuron-specific effects

  • Transcript variant controls: Design assays to detect all known transcript variants individually and total transcripts using conserved regions

  • Protein turnover considerations: When examining protein levels, consider the estimated turnover rate (6-9 hours in cell lines)

These controls ensure that observed changes in C9orf72 expression are specifically related to neuronal activity rather than general cellular stress or artifacts.

How can researchers effectively study the interaction between rat C9orf72 homolog and the stress granule formation pathway?

To investigate the role of rat C9orf72 homolog in stress granule dynamics, researchers should implement a comprehensive approach:

  • Live-cell imaging using fluorescently tagged stress granule markers (G3BP1, TIA-1) in cells with manipulated C9orf72 expression

  • Time-course analysis of stress granule formation following various stressors (arsenite, thapsigargin, heat shock)

  • Super-resolution microscopy to analyze co-localization of C9orf72 with stress granule components

  • FRAP (Fluorescence Recovery After Photobleaching) analysis to assess stress granule dynamics and protein exchange rates

  • Proximity ligation assays to confirm direct interactions between C9orf72 and stress granule proteins

  • RNA immunoprecipitation to identify potential RNA targets of C9orf72 within stress granules

Evidence suggests that C9orf72 delays stress granule formation by interacting with eIF2α in stressed cells . This interaction can be specifically probed using phospho-specific antibodies against eIF2α-P (Ser51) to determine how phosphorylation status affects the interaction.

What approaches can be used to study the role of rat C9orf72 homolog in the unfolded protein response?

To investigate the role of rat C9orf72 homolog in the unfolded protein response (UPR), researchers should implement the following methodological approaches:

  • Measure baseline expression of UPR markers (BiP, CHOP, ATF4, XBP1 splicing) in C9orf72 knockout versus wild-type cells/tissues

  • Challenge cells with ER stressors (tunicamycin, thapsigargin) and compare the kinetics and magnitude of UPR activation

  • Assess the three UPR branches separately:

    • PERK pathway: measure eIF2α phosphorylation, ATF4 levels, and downstream targets

    • IRE1 pathway: quantify XBP1 splicing using specific PCR assays

    • ATF6 pathway: monitor ATF6 processing and nuclear translocation

  • Use UPR reporter systems (e.g., UPRE-luciferase) to quantify pathway activation

  • Perform polysome profiling to assess translational changes during ER stress

Research indicates that C9orf72 knockout results in primary ER stress with activated UPR in rat tissues, particularly in the spleen, contributing to inflammation . This suggests that C9orf72 normally functions to suppress or regulate the UPR, potentially through its interaction with eIF2α.

How should researchers investigate potential species-specific differences between human C9orf72 and the rat homolog?

Despite high sequence conservation between human C9orf72 and its rat homolog, species-specific functional differences may exist. To systematically investigate these differences:

  • Perform cross-species complementation experiments:

    • Express human C9orf72 in rat knockout cells/tissues and assess rescue of phenotypes

    • Express rat C9orf72 homolog in human cells with C9orf72 knockdown

  • Compare protein interaction networks:

    • Conduct IP-MS experiments with both human and rat proteins in the same cellular background

    • Create quantitative interaction maps to identify shared and unique binding partners

  • Analyze regulatory differences:

    • Compare promoter regions and transcription factor binding sites

    • Assess responsiveness to stimuli (neuronal activity, stress) between species

  • Evaluate protein localization and trafficking:

    • Perform parallel subcellular fractionation and immunofluorescence studies

    • Analyze dynamics using photoactivatable or photoconvertible tags

  • Create chimeric proteins swapping domains between human and rat to identify functionally divergent regions

These approaches will help determine whether the rat homolog is a suitable model for human C9orf72 in all aspects or if there are important functional divergences that must be considered when translating findings.

How should researchers interpret changes in rat C9orf72 homolog expression during neuronal activity?

When analyzing data related to rat C9orf72 homolog expression during neuronal activity, researchers should consider:

  • Temporal dynamics: C9orf72 shows a unique pattern with significant downregulation (48% decrease) occurring during the late wave (6 hours) but not the early wave (2 hours) of activity-dependent transcription . This contrasts with classic immediate early genes like Fos, which show rapid induction.

  • Transcript variant analysis: Examine individual transcript variants (V1, V2, V3) separately as they may show different regulation patterns. Use variant-specific qPCR assays targeting unique exon combinations .

  • Protein-level changes: Note that protein changes may lag behind transcript changes due to protein turnover rates (estimated at 6-9 hours) . This temporal disconnect should be considered when correlating transcript and protein data.

  • Physiological relevance: Consider how activity-dependent downregulation of C9orf72 might contribute to neuronal function. Since C9orf72 reduction is associated with disease mechanisms in ALS/FTD, activity-dependent downregulation might represent a stress response or homeostatic mechanism.

  • Network analysis: Integrate findings with other activity-regulated genes to identify potential co-regulation networks or compensatory mechanisms.

This comprehensive interpretation approach provides context for understanding how neural activity influences C9orf72 expression and its potential implications for neuronal function and disease.

What statistical approaches are recommended for analyzing complex phenotypes in rat C9orf72 homolog knockouts?

When analyzing complex phenotypes in rat C9orf72 homolog knockout models, researchers should implement robust statistical approaches:

  • For time-course experiments (e.g., stress responses, disease progression):

    • Repeated measures ANOVA with appropriate post-hoc tests

    • Mixed-effects models to account for both fixed and random effects

    • Survival analysis methods for progression data

  • For multiparametric phenotypes:

    • Principal component analysis (PCA) to identify major sources of variation

    • Hierarchical clustering to identify patterns across multiple parameters

    • MANOVA for simultaneous analysis of multiple dependent variables

  • For transcriptomic/proteomic datasets:

    • Gene set enrichment analysis (GSEA) to identify affected pathways

    • Weighted gene co-expression network analysis (WGCNA) to identify gene modules

    • Differential expression analysis with multiple testing correction

  • For behavioral analysis:

    • Factorial design analysis to assess interaction effects

    • Non-parametric methods for data that doesn't meet normality assumptions

    • Power analysis to ensure adequate sample sizes based on expected effect sizes

  • General considerations:

    • Implement blinding procedures for subjective assessments

    • Use both male and female animals and include sex as a biological variable in analyses

    • Apply appropriate corrections for multiple comparisons (e.g., Benjamini-Hochberg procedure)

These statistical approaches will help extract meaningful insights from complex datasets while minimizing false discoveries and accounting for biological variability.

How can researchers investigate the relationship between rat C9orf72 homolog and autophagy pathways?

To investigate the relationship between rat C9orf72 homolog and autophagy pathways, researchers should implement the following methodological approach:

  • Baseline autophagy assessment in C9orf72 knockout versus wild-type models:

    • Measure LC3-I to LC3-II conversion via western blotting

    • Monitor autophagic flux using chloroquine or bafilomycin A1 to block lysosomal degradation

    • Quantify autophagosome formation using fluorescent LC3 puncta analysis

    • Assess selective autophagy markers (p62/SQSTM1, OPTN, NDP52)

  • Mechanistic investigations:

    • Examine interactions between C9orf72 and autophagy-related Rab GTPases (particularly Rab1a, Rab5, Rab7, and Rab11)

    • Measure GEF activity of C9orf72 toward autophagy-related Rabs using fluorescence-based nucleotide exchange assays

    • Analyze autophagosome-lysosome fusion efficiency using tandem-fluorescent LC3 (tfLC3) reporters

  • Stimulus-responsive autophagy:

    • Compare starvation-induced, stress-induced, and selective autophagy pathways

    • Examine transcriptional regulation of autophagy genes (ATG5, ATG7, BECN1) in C9orf72-deficient cells

  • Therapeutic implications:

    • Test autophagy modulators (rapamycin, trehalose) in C9orf72 knockout models

    • Assess whether autophagy enhancement rescues C9orf72-deficiency phenotypes

This comprehensive approach will help elucidate the specific roles of rat C9orf72 homolog in autophagy regulation and identify potential therapeutic targets for C9orf72-related diseases.

What approaches should be used to investigate potential therapeutic strategies targeting rat C9orf72 homolog?

For developing therapeutic strategies targeting rat C9orf72 homolog function, researchers should consider both loss-of-function and gain-of-function disease mechanisms:

  • Strategies targeting loss-of-function:

    • Gene therapy approaches to restore C9orf72 expression using AAV vectors

    • Small molecule screening to identify compounds enhancing remaining C9orf72 expression

    • Development of recombinant C9orf72 protein with cell-penetrating peptides for direct delivery

    • Targeting downstream pathways (eIF2α signaling, Rab GTPase function) to bypass C9orf72 deficiency

  • For targeting gain-of-function mechanisms while preserving C9orf72 function:

    • Antisense oligonucleotides (ASOs) designed to reduce toxic repeat-containing RNAs while preserving normal C9orf72

    • CRISPR-based approaches for selective correction of repeat expansions

    • Small molecules disrupting interactions between repeat RNA and RNA-binding proteins

  • Combination approaches:

    • Dual-action therapies addressing both loss- and gain-of-function mechanisms

    • Tiered intervention strategies based on disease stage

  • Evaluation metrics:

    • Restoration of normal eIF2α-eIF2B interactions

    • Normalization of global translation rates

    • Reduction in stress granule abnormalities

    • Improvement in UPR signaling profiles

    • Functional recovery in cellular and animal models

These therapeutic strategies should be evaluated in physiologically relevant models, including patient-derived neurons and rat models expressing the repeat expansion, with careful consideration of both efficacy and potential side effects.

What are the critical unresolved questions about rat C9orf72 homolog function?

Despite significant advances, several critical questions about rat C9orf72 homolog function remain unresolved:

  • The complete set of Rab GTPase targets for C9orf72's GEF activity remains undefined. While bioinformatic analyses suggest C9orf72 functions as a GEF , the specific Rab targets in rat neurons and their relevance to disease mechanisms need further characterization.

  • The precise mechanism by which C9orf72 regulates the UPR and stress granule formation requires clarification. While interaction with eIF2α has been demonstrated , the full signaling cascade and regulatory networks involved remain incompletely understood.

  • The tissue-specific consequences of C9orf72 deficiency need further investigation. The pronounced inflammatory phenotype in rat spleen contrasts with the predominant neurodegeneration in human disease, suggesting context-dependent functions that require further study.

  • The activity-dependent regulation of C9orf72 raises questions about its role in neuronal plasticity and homeostasis. Does this regulation serve a protective function or contribute to vulnerability in neurons with high activity levels?

  • The therapeutic potential of targeting the rat C9orf72 homolog needs exploration in the context of human C9orf72-related diseases. Can findings in rat models translate to effective human therapies?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.