Recombinant Rat Transmembrane protein ENSP00000340100 homolog

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional fees.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
Fam205c; Protein FAM205C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-329
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Fam205c
Target Protein Sequence
MLIPPFILWDVGYSVYTYGSIFIIALIIWQVKRSHRGLRMGPTKSCAKCFRRIKQTPSDR ATRAKRTSKEEAEKLQKLLDTMKSQGWLPQEGSVRRLLCPDPSCSICNAMTLEIQQLLGV ENKKTSSSLLRPSRSFSCLEALSPSKSLADRSSELTYQDTRDVSLSSRFPQSQETDQQST RSATPSIGDAVLQCYHSAPQQQLDPQGSKMTQDAKGLSSSSTDEPGVPANQQKKRKKTKK LALKNQAAPTEVETENKMTFFSHWVNPEVKCDRQEESLVFSKYDTGAKPMTVEPEKTHSP VRDQAEGAEKKKKPECDLKAKPLRAKRNI
Uniprot No.

Target Background

Database Links

KEGG: rno:500445

UniGene: Rn.123202

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

How does the structure of Rat FAM205C compare with homologs in other species?

Comparative analysis of FAM205C across species reveals structural conservation with varying lengths. The rat version (329 amino acids) differs from the bovine homolog (408 amino acids), suggesting species-specific adaptations or variations in protein function . When studying this protein, researchers should consider these interspecies differences, particularly when extrapolating findings across model organisms. Sequence alignment studies indicate conserved domains, particularly in the transmembrane regions, while C-terminal regions show greater variability across species .

What are the optimal reconstitution and storage conditions for working with this recombinant protein?

For optimal results when working with Recombinant Rat Transmembrane protein ENSP00000340100 homolog, follow these evidence-based protocols:

Reconstitution Protocol:

  • Briefly centrifuge the vial before opening to collect all material at the bottom

  • Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is recommended by manufacturers)

  • Aliquot for long-term storage to minimize freeze-thaw cycles

Storage Conditions:

  • Store at -20°C/-80°C upon receipt

  • For extended storage, maintain at -20°C/-80°C in aliquots

  • Working aliquots can be stored at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles as this significantly reduces protein stability

This approach is similar to storage protocols used for other recombinant proteins such as Recombinant Rat TRANCE/RANK L/TNFSF11, which also requires careful temperature management to maintain bioactivity .

How can I verify the purity and integrity of the recombinant protein before experiments?

To verify the purity and integrity of Recombinant Rat Transmembrane protein ENSP00000340100 homolog before experimentation, employ the following complementary analytical techniques:

  • SDS-PAGE Analysis: Run both reducing and non-reducing SDS-PAGE gels to assess protein purity. Commercial preparations typically achieve >90% purity as determined by this method .

  • Western Blot Analysis: Using anti-His antibodies to detect the N-terminal His-tag can confirm the identity of the recombinant protein.

  • Mass Spectrometry: For precise molecular weight confirmation and detection of potential post-translational modifications or degradation products.

  • Circular Dichroism: To evaluate secondary structure integrity and proper folding.

  • Dynamic Light Scattering: To assess protein homogeneity and detect potential aggregation.

These analytical approaches should be performed systematically before conducting functional assays to ensure experimental reproducibility and valid interpretation of results.

What methodologies are most effective for studying protein-protein interactions involving Recombinant Rat Transmembrane protein ENSP00000340100 homolog?

For investigating protein-protein interactions involving this transmembrane protein, multiple complementary approaches should be employed:

In Vitro Methods:

  • Pull-down Assays: Utilizing the His-tag for affinity purification of protein complexes, similar to techniques used with other His-tagged recombinant proteins .

  • Surface Plasmon Resonance (SPR): For quantitative binding kinetics measurements.

  • Isothermal Titration Calorimetry (ITC): To determine thermodynamic parameters of binding.

Cell-Based Methods:

  • Yeast Two-hybrid: For initial screening of potential interacting partners.

  • Bimolecular Fluorescence Complementation (BiFC): For visualizing interactions in living cells.

  • FRET/BRET Assays: For studying dynamic interactions in real-time.

In Silico Approaches:

  • Molecular Docking: To predict interaction interfaces.

  • Sequence-based Interaction Prediction: Using algorithms that identify potential binding motifs.

When designing interaction studies, it's critical to include appropriate controls as demonstrated in ligand binding assays performed with other recombinant rat proteins like Agrin, where specific binding parameters were carefully established .

How do membrane environment conditions affect the stability and function of this protein?

The membrane environment significantly impacts the stability and function of transmembrane proteins like FAM205C. Key considerations include:

Lipid Composition Effects:

  • Different lipid compositions can alter protein conformation and activity

  • Consider using native-like lipid compositions when reconstituting the protein for functional studies

Detergent Selection:

  • For extraction and purification, optimal detergent screening is essential

  • Mild non-ionic detergents (e.g., DDM, LMNG) often preserve protein structure

  • Monitor protein stability in various detergents using thermal shift assays

pH and Ionic Strength:

  • Transmembrane proteins demonstrate pH-dependent stability and function

  • Similar to observations with recombinant rat HARE, which showed temperature-dependent conformational changes affecting ligand binding

Temperature Sensitivity:

  • Temperature can induce conformational changes that affect function

  • Some transmembrane proteins exhibit different binding specificities at 4°C versus 37°C, as demonstrated with recombinant rat HARE

Experimental design should systematically evaluate these parameters to optimize conditions for functional studies.

What are the challenges in obtaining consistent experimental results with this recombinant protein?

Working with Recombinant Rat Transmembrane protein ENSP00000340100 homolog presents several challenges that researchers should anticipate and address:

  • Protein Aggregation Issues:

    • Transmembrane proteins have hydrophobic domains prone to aggregation

    • Solution: Optimize buffer conditions with appropriate detergents and stabilizing agents

  • Expression System Limitations:

    • E. coli-expressed transmembrane proteins may lack proper folding or post-translational modifications

    • Solution: Consider mammalian or insect cell expression systems for more complex studies

  • Batch-to-Batch Variability:

    • Different preparations may show variable activity

    • Solution: Implement rigorous quality control testing and use internal standards across experiments

  • Temperature-Dependent Conformational Changes:

    • As observed with other recombinant rat proteins like HARE, binding properties may vary at different temperatures

    • Solution: Standardize temperature conditions and include temperature controls in experimental design

  • Storage-Related Degradation:

    • Repeated freeze-thaw cycles reduce protein integrity

    • Solution: Store as recommended with glycerol and use working aliquots

How can I distinguish between specific and non-specific binding in protein interaction studies?

To rigorously differentiate between specific and non-specific binding in studies with Recombinant Rat Transmembrane protein ENSP00000340100 homolog:

Experimental Controls:

  • Negative Controls:

    • Use non-related proteins with similar tags to control for tag-mediated interactions

    • Include competition assays with unlabeled protein

    • Test binding with denatured protein preparations

  • Concentration-Dependent Studies:

    • Specific binding typically shows saturation kinetics

    • Perform binding assays at multiple protein concentrations to generate binding curves

    • Calculate Kd values as demonstrated with recombinant rat Agrin protein (Kd <3 nM)

  • Mutational Analysis:

    • Generate site-directed mutants of key residues predicted to be involved in specific interactions

    • Compare binding parameters between wild-type and mutant proteins

  • Cross-Validation:

    • Confirm interactions using multiple independent techniques (e.g., pull-down, SPR, ELISA)

    • Consider functional assays to validate biological relevance of observed interactions

  • Statistical Analysis:

    • Apply appropriate statistical tests to distinguish signal from noise

    • Consider methods like Scatchard analysis for quantitative binding studies

What are the potential functional roles of FAM205C based on sequence analysis and homology studies?

Sequence analysis and homology studies suggest several potential functional roles for FAM205C:

  • Transmembrane Signaling:

    • The presence of a transmembrane domain indicates possible involvement in signal transduction pathways

    • The cytoplasmic domain contains potential phosphorylation sites that may regulate signaling activity

  • Protein-Protein Interactions:

    • The C-terminal region contains multiple lysine residues that may serve as interaction interfaces

    • The sequence KKRKKTKK suggests a potential nuclear localization signal, indicating possible nuclear functions

  • DNA/RNA Binding:

    • The presence of basic amino acid clusters suggests potential nucleic acid binding capability

    • This is consistent with other proteins containing similar motifs that function in transcriptional regulation

  • Evolutionary Conservation:

    • Comparison with bovine homolog indicates conserved domains that likely represent functionally important regions

    • This approach parallels studies of other recombinant rat proteins like CBF-C, where cross-species functional conservation was demonstrated

Current research has not fully elucidated these functions, presenting opportunities for novel investigations using techniques similar to those employed with other recombinant rat proteins like MCSF .

What are the most promising experimental approaches for determining the physiological function of this protein?

To elucidate the physiological function of Recombinant Rat Transmembrane protein ENSP00000340100 homolog, consider these integrated research approaches:

  • Gene Editing and Knockdown Studies:

    • CRISPR/Cas9-mediated knockout in cell lines and animal models

    • siRNA or shRNA knockdown followed by phenotypic analysis

    • Rescue experiments with recombinant protein to confirm specificity

  • Proteomics Approaches:

    • Immunoprecipitation followed by mass spectrometry to identify interaction partners

    • Phosphoproteomics to identify post-translational modifications

    • Comparative proteomics between wild-type and knockout models

  • Localization Studies:

    • Immunofluorescence microscopy with specific antibodies

    • Live-cell imaging with fluorescently tagged protein

    • Subcellular fractionation followed by Western blotting

  • Functional Assays:

    • Cell proliferation, migration, and differentiation assays

    • Signaling pathway activation studies

    • Membrane potential measurements if ion channel function is suspected

  • Structural Biology:

    • X-ray crystallography or cryo-EM studies

    • NMR analysis of specific domains

    • Molecular dynamics simulations based on structural data

These approaches should be combined systematically, similar to methodologies used to characterize other recombinant rat proteins such as the 175-kDa hyaluronan receptor and MCSF , where multiple complementary techniques revealed functional properties.

What are the most effective strategies for overcoming solubility issues with this transmembrane protein?

Addressing solubility challenges with Recombinant Rat Transmembrane protein ENSP00000340100 homolog requires a systematic approach:

Buffer Optimization:

  • Screen multiple buffer systems (HEPES, Tris, phosphate) at various pH values (6.5-8.5)

  • Test different salt concentrations (150-500 mM NaCl) to identify optimal ionic strength

  • Include stabilizing agents such as glycerol (5-20%) or specific amino acids (arginine, glutamate)

Detergent Selection:

  • Evaluate a panel of detergents including:

    • Non-ionic (DDM, DM, LMNG)

    • Zwitterionic (CHAPS, CHAPSO)

    • Novel amphipols or styrene maleic acid lipid particles (SMALPs)

  • Determine critical micelle concentration (CMC) for each detergent and test at multiples of CMC

Protein Modification Approaches:

  • Consider fusion proteins (MBP, SUMO) that enhance solubility

  • Test truncated constructs that remove highly hydrophobic regions

  • Introduce specific mutations that enhance solubility without affecting function

Expression Conditions:

  • Lower induction temperature (16-20°C) to slow protein synthesis and improve folding

  • Co-express with chaperones to assist proper folding

  • Consider alternative expression systems (insect cells, mammalian cells) for complex transmembrane proteins

These approaches have proven effective with other challenging recombinant rat proteins and should be systematically tested and documented .

How can I optimize experimental design to study temperature-dependent conformational changes in this protein?

Based on observations with other recombinant rat proteins showing temperature-dependent conformational changes , the following experimental design is recommended:

Temperature-Controlled Binding Studies:

  • Perform parallel binding assays at multiple temperatures (4°C, 22°C, 37°C)

  • Include appropriate controls at each temperature

  • Calculate binding kinetics parameters (kon, koff, Kd) at each temperature

  • Plot Arrhenius plots to determine activation energies of binding

Structural Analysis Techniques:

  • Circular Dichroism (CD) spectroscopy at varying temperatures to monitor secondary structure changes

  • Differential Scanning Calorimetry (DSC) to determine thermal transition points

  • Temperature-dependent NMR to identify specific residues involved in conformational changes

  • Limited proteolysis at different temperatures followed by mass spectrometry

Functional Correlation Studies:

  • Develop functional assays that can be performed at different temperatures

  • Correlate changes in function with observed structural transitions

  • Design mutants targeting residues suspected to mediate temperature sensitivity

  • Test whether temperature-dependent changes are reversible or irreversible

This systematic approach will help characterize any temperature-dependent properties of Recombinant Rat Transmembrane protein ENSP00000340100 homolog, similar to the temperature-dependent GAG recognition observed with recombinant rat HARE .

How does the methodology for working with Recombinant Rat Transmembrane protein ENSP00000340100 homolog compare with approaches for other transmembrane proteins?

The methodological approaches for working with Recombinant Rat Transmembrane protein ENSP00000340100 homolog share core principles with other transmembrane proteins but require specific optimizations:

Methodological AspectFAM205C ApproachOther Transmembrane ProteinsKey Differences
Expression SystemE. coli with N-terminal His-tag Various (E. coli, insect cells, mammalian cells)FAM205C appears less toxic to E. coli than many TMPs
Purification StrategyIMAC purification via His-tag Similar for tagged proteins; size exclusion chromatography often addedStandard approach aligns with other TMPs
Storage BufferTris/PBS-based buffer with 6% trehalose, pH 8.0 Often glycerol-based; sometimes detergent-containingUnique use of trehalose as stabilizer
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mL with 5-50% glycerol Often directly into detergent-containing buffersSimilar to general approaches
Temp. SensitivityPotential temperature-dependent conformational changes (based on similar proteins) Variable; some show temperature dependenceRequires specific temperature controls
Solubility EnhancementLikely requires detergents (specific data not available)Detergents, lipid nanodiscs, amphipolsStandard approaches should apply

The protocols developed for Recombinant Rat Transmembrane protein ENSP00000340100 homolog build on established methods while incorporating specific optimizations based on the protein's characteristics.

What lessons from research on other recombinant rat proteins can be applied to studies of FAM205C?

Insights from studies of other recombinant rat proteins provide valuable lessons applicable to FAM205C research:

  • Temperature-Dependent Conformational Changes:

    • Research on recombinant rat HARE demonstrated temperature-dependent GAG binding specificity

    • Application: Design experiments at multiple temperatures to fully characterize FAM205C binding properties

  • Multi-technique Validation Approach:

    • Studies with recombinant rat CBF-C employed multiple complementary techniques to confirm heteromeric interactions

    • Application: Use multiple independent methods to validate any observed FAM205C interactions

  • Evolutionary Conservation Analysis:

    • Recombinant rat CBF-C research revealed functional conservation across species

    • Application: Compare FAM205C function across species to identify conserved, functionally critical domains

  • Activity Assay Development:

    • Research on recombinant rat MCSF established specific bioactivity assays (NFS-60 cell proliferation)

    • Application: Develop specific cellular assays to quantitatively measure FAM205C activity

  • Binding Kinetics Quantification:

    • Studies with recombinant rat Agrin established precise binding parameters (Kd <3 nM)

    • Application: Determine quantitative binding constants for any FAM205C interactions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.