Recombinant Rat Tricarboxylate transport protein, mitochondrial (Slc25a1)

Shipped with Ice Packs
In Stock

Description

Molecular Identity and Characteristics

The Tricarboxylate transport protein is encoded by the Slc25a1 gene in rats and belongs to the mitochondrial carrier subfamily of solute carrier proteins. These nuclear-encoded transporters are responsible for translocating small metabolites across the mitochondrial membrane . The protein is known by several alternative names as shown in the table below:

Gene SymbolAlternative Gene NamesProtein Names
Slc25a1Cic, Ctp, Slc20a3Tricarboxylate transport protein, mitochondrial; Citrate transporter; Mitochondrial citrate carrier

The rat liver mitochondrial tricarboxylate transport protein has been extensively characterized through molecular cloning and sequencing. The complete cDNA clone spans 1927 base pairs, with 5'- and 3'-untranslated regions of 419 and 572 base pairs, respectively . The open reading frame encodes a mature transport protein consisting of 298 amino acids, preceded by a presequence of 13 residues that likely functions as a mitochondrial targeting signal .

Structural analysis reveals that the Slc25a1 protein contains three related sequence domains, each approximately 100 amino acids in length . These domains share homology not only with each other but also with similar domains found in other mitochondrial transporters, suggesting a common evolutionary origin for this protein family. Hydrophobicity analysis predicts the presence of six membrane-spanning alpha-helices, with two helices in each of the three sequence domains .

Transport Activities

The primary function of Slc25a1 is to mediate the exchange of mitochondrial citrate for cytosolic malate . This process is crucial for providing citrate from the mitochondrial matrix to the cytosol, where it serves as a key substrate for lipid synthesis and other metabolic pathways.

Beyond its primary role, Slc25a1 demonstrates versatility in substrate recognition, capable of mediating the exchange of citrate for several other metabolites:

Primary SubstratesSecondary Substrates
Citrate/MalateIsocitrate
Citrate/CitratePhosphoenolpyruvate
Cis-aconitate
Maleate (lesser extent)
Succinate (lesser extent)

Research with reconstituted liposomes has demonstrated high-efficiency transport of citrate, with experimental models showing a Km value of 0.01 mM at 25°C . Although this specific value was observed in a fungal model, it provides insight into the general transport mechanisms of mitochondrial citrate carriers.

Metabolic Significance

In cellular metabolism, Slc25a1 plays a pivotal role by facilitating the transport of citrate from the mitochondrial matrix to the cytosol . Once in the cytosol, citrate is cleaved by ATP-citrate lyase into acetyl-coenzyme A and oxaloacetate . This process has several critical metabolic implications:

  1. The generated acetyl-coenzyme A serves as the primary substrate for fatty acid and sterol biosynthesis .

  2. Oxaloacetate is typically reduced to malate and transported back into the mitochondria, maintaining a continuous cycle .

  3. Cytosolic citrate can inhibit phosphofructokinase 1, thereby influencing glycolytic rates .

  4. Both citrate and malate participate in regulating cellular NADPH content, essential for biosynthetic processes .

Slc25a1 is particularly important for the bioenergetics of hepatic cells, providing both a carbon source for fatty acid and sterol biosyntheses and NAD(+) for the glycolytic pathway . This positions the protein as a key regulator at the intersection of carbohydrate and lipid metabolism.

Protein Interactions

Functional partnership analysis has identified several proteins that interact with or functionally relate to Slc25a1, highlighting its integration within broader metabolic networks:

ProteinFunctionInteraction Score
CsCitrate synthase, mitochondrial0.956
AclyATP-citrate synthase0.856
Mrpl4039S ribosomal protein L40, mitochondrial0.810
Tango2Transport and golgi organization 2 homolog0.757
Pole2DNA polymerase epsilon subunit0.745

Expression and Purification

Recombinant rat Slc25a1 has been successfully expressed in various systems, including bacterial expression systems such as Escherichia coli . The expression of the protein in these systems allows for large-scale production necessary for structural and functional studies.

The purification of recombinant Slc25a1 typically involves affinity chromatography techniques, taking advantage of added tags or the protein's specific binding properties. The purified protein can then be reconstituted into liposomes to study its transport activities or used for structural analyses .

Research Applications

Recombinant Slc25a1 serves as an invaluable tool for various research applications:

  1. Studying transport mechanisms and kinetics through reconstituted liposome systems

  2. Investigating the effects of mutations on protein function

  3. Screening for inhibitors or modulators of transport activity

  4. Generating antibodies for detection and localization studies

Antibodies raised against recombinant rat Slc25a1 have been employed for protein detection in various tissues and experimental systems . For instance, polyclonal antibodies raised in rabbits against recombinant rat Slc25a1 carrier have been used in Western blot analyses to study the protein's expression and distribution .

Role in Neuromuscular Junction Formation

Beyond its metabolic functions, Slc25a1 has been found to play a critical role in neuromuscular junction formation . This unexpected role suggests that citrate transport and the resulting metabolic changes may influence cellular differentiation and tissue development in ways not previously appreciated.

Research has shown that knockdown of SLC25A1 expression in zebrafish mirrors human disease phenotypes, including variable brain, eye, and cardiac involvement, as well as clear abnormalities in the neuromuscular junction regardless of the severity of the phenotype . These findings underscore the importance of Slc25a1 in neurodevelopment and proper synapse formation.

Associated Disorders

Mutations in the SLC25A1 gene have been associated with several disorders:

DisorderCharacteristicsReference
Combined D-2- and L-2-hydroxyglutaric aciduriaRare neurometabolic disorder
Neuromuscular junction defectVariable severity; affects brain, eyes, cardiac tissue

The clinical phenotypes associated with SLC25A1 mutations vary considerably. Some mutations result in severe, often lethal conditions, while others lead to milder manifestations primarily presenting as neuromuscular junction defects .

Mechanistic Insights from Disease Models

Studies using animal models have provided valuable insights into the pathophysiological mechanisms underlying SLC25A1-related disorders. In one study, mitochondria isolated from a citrate transporter-overexpressing transformant showed a 51% increase in the efflux rate of [14C] citrate in the presence of malate, whereas mitochondria from a knockout transformant showed an 18% decrease compared to wild-type . These findings demonstrate the direct correlation between transporter expression levels and citrate efflux capacity.

Future Research Directions

The continued study of recombinant rat Slc25a1 presents several promising avenues for future research:

  1. Detailed structural analyses using advanced techniques such as cryo-electron microscopy to elucidate the molecular mechanisms of substrate recognition and transport

  2. Investigation of regulatory mechanisms controlling Slc25a1 activity and expression under various physiological and pathological conditions

  3. Development of specific inhibitors or modulators of Slc25a1 as potential therapeutic agents for metabolic disorders

  4. Further exploration of the protein's roles in neurodevelopment and synapse formation

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. You may adjust this as needed.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. The shelf life of lyophilized forms is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. For multiple uses, aliquoting is necessary. To maintain protein integrity, avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
Slc25a1; Slc20a3; Tricarboxylate transport protein, mitochondrial; Citrate transport protein; CTP; Solute carrier family 25 member 1; Tricarboxylate carrier protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
14-311
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Slc25a1
Target Protein Sequence
APGSGKAKLTHPGKAILAGGLAGGIEICITFPTEYVKTQLQLDERANPPRYRGIGDCVRQ TVRSHGVLGLYRGLSSLLYGSIPKAAVRFGMFEFLSNHMRDAQGRLDSRRGLLCGLGAGV AEAVVVVCPMETVKVKFIHDQTSSNPKYRGFFHGVREIVREQGLKGTYQGLTATVLKQGS NQAIRFFVMTSLRNWYQGDNPNKPMNPLITGVFGAVAGAASVFGNTPLDVIKTRMQGLEA HKYRNTLDCGVQILKNEGPKAFYKGTVPRLGRVCLDVAIVFVIYDEVVKLLNKVWKTD
Uniprot No.

Target Background

Function
The tricarboxylate transport protein (Slc25a1) is a mitochondrial citrate transporter that facilitates the exchange of mitochondrial citrate for cytosolic malate. It can also mediate the exchange of citrate for isocitrate, phosphoenolpyruvate, cis-aconitate (but not trans-aconitate), and to a lesser extent, maleate and succinate. This protein plays a crucial role in hepatic cell bioenergetics by providing a carbon source for fatty acid and sterol biosynthesis, and NAD+ for the glycolytic pathway. Furthermore, it is essential for proper neuromuscular junction formation.
Gene References Into Functions
  1. Studies suggest that in starved rats, the regulation of hepatic citrate carrier expression occurs at the posttranscriptional level. PMID: 12445817
  2. Research indicates that the citrate carrier (CIC) presequence is dispensable for both targeting to mitochondria and insertion into the inner membrane. PMID: 12488104
  3. Administration of n-6 PUFAs to rats leads to changes not only in the transcriptional rate of the tricarboxylate (citrate) carrier gene but also in the processing of the nuclear precursor for TCC RNA. PMID: 15060089
  4. Different dietary fatty acids exhibit distinct effects on the activity and gene expression of Ctp. PMID: 15589833
  5. Data demonstrate that under conditions of increased ionic strength, the citrate carrier precursor protein presequence binds to Tom20 and accumulates at the mitochondrial surface. PMID: 16129883
  6. The export of citrate and/or isocitrate from the mitochondria to the cytosol through Slc25a1 is a key step in the control of glucose-stimulated insulin secretion. PMID: 17001083

Show More

Hide All

Database Links

KEGG: rno:29743

STRING: 10116.ENSRNOP00000000306

UniGene: Rn.8368

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the primary function of Slc25a1 in cellular metabolism?

Slc25a1, also known as the mitochondrial citrate carrier, is a transmembrane protein located in the inner mitochondrial membrane that facilitates the exchange of mitochondrial citrate/isocitrate with cytosolic malate. This transport mechanism is crucial for several metabolic pathways. Within mitochondria, both citrate and malate participate in energy-producing reactions, while exported citrate serves critical functions in the cytosol . Once transported to the cytosol, citrate is cleaved into acetyl-coenzyme A and oxaloacetate by ATP-citrate lyase. Acetyl-coenzyme A subsequently serves as the main substrate for lipid and sterol biosynthesis, while oxaloacetate is typically reduced to malate and returned to the mitochondria for further exchange with mitochondrial citrate . Through this exchange mechanism, Slc25a1 connects mitochondrial and cytosolic metabolism, playing a pivotal role in fatty acid synthesis, sterol biosynthesis, gluconeogenesis, and glycolysis regulation .

What structural characteristics enable Slc25a1 to function as a transporter?

The protein surface displays distinct electrostatic properties: positively charged regions (blue), negatively charged regions (red), and predominantly non-polar regions (white). The extensive hydrophobic surface facilitates the protein's integration into the mitochondrial membrane. Notably, the binding interface between the two subunits in the dimer occurs exclusively in non-polar hydrophobic regions, emphasizing the importance of hydrophobic interactions in maintaining the quaternary structure critical for transport function .

How is Slc25a1 expression and activity regulated in different tissues?

Slc25a1 expression and activity exhibit tissue-specific regulation patterns that correspond to the metabolic demands of different cell types. In adipocytes, Slc25a1 activity is regulated through the IL-1R-IRAKM-Slc25a1 signaling pathway. IL-1β stimulation induces the translocation of IRAKM to mitochondria, where it phosphorylates Slc25a1 at Threonine 155, enhancing citrate transport activity and promoting de novo fatty acid synthesis .

The tissue-specific importance of Slc25a1 is further highlighted by its critical role in cardiac development. Systemic knockout of Slc25a1 in mice results in impaired embryonic growth, cardiac malformations, and mitochondrial ultrastructural defects. Transcriptomic analyses revealed that Slc25a1 deletion causes widespread alterations in metabolic gene expression in cardiac tissue, particularly downregulating oxidative phosphorylation while increasing reliance on glucose metabolism .

In brain tissue, Slc25a1 function is particularly crucial, as evidenced by the severe neurological consequences of Slc25a1 mutations in conditions like combined D,L-2-hydroxyglutaric aciduria. Brain cells appear most vulnerable to the metabolic disruptions caused by Slc25a1 dysfunction, suggesting tissue-specific dependence on proper citrate transport .

What are the common genetic variants of Slc25a1 and their functional implications?

At least 12 different mutations in the SLC25A1 gene have been identified in association with combined D,L-2-hydroxyglutaric aciduria (D,L-2-HGA). These mutations significantly reduce the function of the SLC25A1 protein, disrupting citrate and malate transport across the mitochondrial membrane . The consequent metabolic derangements include abnormal accumulation of D-2-hydroxyglutarate and L-2-hydroxyglutarate, which at elevated levels can damage cells and lead to cell death, particularly affecting brain tissue .

Additionally, specific SLC25A1 mutations have been linked to congenital myasthenic syndromes, characterized by fatigable weakness due to neuromuscular junction malfunction. While some SLC25A1 mutations cause severe, often lethal phenotypes, others result in milder presentations primarily affecting neuromuscular junction function .

The functional implications of these genetic variants include:

  • Disrupted energy production due to impaired citrate-malate exchange

  • Reduced cytosolic citrate availability affecting lipid synthesis

  • Accumulation of potentially toxic metabolites in neural tissues

  • Altered acetyl-CoA availability affecting protein acetylation and gene expression regulation

  • Compromised neuromuscular junction development and function

How does phosphorylation of Slc25a1 at Threonine 155 mechanistically alter its transport activity?

The phosphorylation of Slc25a1 at Threonine 155 (Thr155) represents a critical post-translational modification that significantly enhances its transport activity. Research utilizing recombinant protein and in vitro kinase assays has demonstrated that IRAKM specifically phosphorylates Slc25a1 at this residue . When compared to wild-type Slc25a1, the non-phosphorylatable T155A mutant exhibits substantially reduced citrate transport activity in response to IL-1β stimulation .

Mechanistically, this phosphorylation appears to modify the conformational dynamics of the protein, potentially affecting:

  • The binding affinity for citrate and malate substrates

  • The rate of conformational changes required for transport cycle completion

  • The stability of the protein's active dimeric state

  • Interactions with other proteins or cofactors that influence transport activity

Experimental evidence shows that following IL-1β stimulation, IRAKM translocates to mitochondria where it interacts with and phosphorylates Slc25a1. This post-translational modification is essential for IL-1β-induced transport of mitochondrial citrate to the cytosol and subsequent de novo fatty acid synthesis in adipocytes .

The significance of this phosphorylation extends beyond basic transport function, as it represents a regulatory mechanism linking inflammatory signaling (via IL-1β) to metabolic reprogramming. Researchers working with recombinant Slc25a1 should consider the phosphorylation state of the protein when designing experiments to assess transport function or when comparing results between different experimental conditions.

What is the role of the IL-1R-IRAKM-Slc25a1 signaling axis in metabolic disorders?

The IL-1R-IRAKM-Slc25a1 signaling axis constitutes an unconventional pathway in adipocytes that links inflammatory signaling to metabolic reprogramming, particularly in the context of diet-induced obesity . This pathway functions through the following sequence:

  • IL-1β binding to IL-1R initiates inflammatory signaling

  • IRAKM is activated and translocates to mitochondria

  • Mitochondrial IRAKM interacts with and phosphorylates Slc25a1 at Threonine 155

  • Phosphorylated Slc25a1 increases citrate transport from mitochondria to cytosol

  • Elevated cytosolic citrate enhances de novo fatty acid synthesis

  • Increased lipogenesis contributes to adipocyte hypertrophy and obesity development

This signaling cascade offers a mechanistic explanation for how chronic inflammation may contribute to metabolic disorders. Research indicates that disrupting this pathway, either through IRAKM kinase inactivation or by expressing non-phosphorylatable Slc25a1 (T155A), reduces IL-1β-induced fatty acid synthesis in adipocytes and decreases lipid accumulation in both white and brown adipose tissues from high-fat diet-fed mice .

These findings suggest that targeting the IL-1R-IRAKM-Slc25a1 axis could represent a novel therapeutic approach for obesity-related pathologies. Specifically, disrupting IRAKM-Slc25a1 interactions or developing specific IRAKM inhibitors might offer potential strategies for treating obesity and associated metabolic disorders .

How does Slc25a1 contribute to cardiac development and what are the consequences of its dysfunction?

Slc25a1 plays a critical role in cardiac development by regulating the metabolic maturation necessary for proper heart morphogenesis. Research using systemic knockout of Slc25a1 in mice has demonstrated that Slc25a1 deficiency results in:

  • Impaired embryonic growth

  • Cardiac malformations

  • Mitochondrial ultrastructural defects

  • Impaired mitochondrial oxygen consumption

  • Widespread alterations in metabolic gene expression

Metabolic modeling predicts that loss of Slc25a1 downregulates oxidative phosphorylation while increasing reliance on glucose metabolism. Furthermore, Slc25a1 deletion decreases cardiac H3K9 acetylation levels at promoter regions, suggesting an epigenetic mechanism by which Slc25a1 influences cardiac development .

The contribution of Slc25a1 to cardiac development appears to involve:

  • Regulation of metabolic reprogramming from glycolysis toward mitochondrial oxidative metabolism during cardiac development

  • Maintenance of mitochondrial structure and function in cardiomyocytes

  • Influence on the epigenetic landscape through modulation of acetyl-CoA availability for histone acetylation

  • Support of energy-demanding processes during cardiac morphogenesis

These findings are particularly relevant in understanding the cardiac manifestations of 22q11.2 deletion syndrome (22q11.2DS), as SLC25A1 is located within the 22q11.2DS microdeletion region. Approximately 75% of patients with 22q11.2DS present with congenital heart defects, suggesting that SLC25A1 haploinsufficiency may contribute to the cardiac phenotype in this syndrome .

What experimental approaches are most effective for studying Slc25a1 transport kinetics?

Several experimental approaches have proven effective for studying Slc25a1 transport kinetics, each with specific advantages for addressing different research questions:

Liposome Reconstitution Assays

This approach involves purifying recombinant Slc25a1 and reconstituting it into liposomes to measure transport activity. The methodology includes:

  • Preparation of proteoliposomes either loaded with substrate (exchange) or empty

  • Initiation of transport by adding radioactive [14C] citrate

  • Termination of the reaction using specific inhibitors (e.g., 20 mM pyridoxal 5'-phosphate)

  • Separation of external radioactivity from proteoliposomes using Sephadex G-75

  • Measurement of radioactivity using liquid scintillation analysis

This method allows for precise determination of transport kinetics and substrate specificity under controlled conditions. Linear regression analysis of transport results can yield accurate Km values for different substrates.

Cellular Models with Genetic Modifications

These approaches use gene overexpression or knockout strategies:

  • Plasmid constructs for Slc25a1 overexpression (e.g., pMAT2085)

  • Knockout vectors carrying selectable markers flanked by homologous regions (e.g., pMAT2060)

  • Creation of specific mutations (e.g., T155A) to study structure-function relationships

  • Measurement of citrate transport in intact cells or isolated mitochondria

Molecular Docking and Structural Modeling

Computational approaches provide insights into substrate binding and transport mechanisms:

  • Prediction of protein structure using threading methods (e.g., I-TASSER)

  • Evaluation of model plausibility using C-score metrics

  • Molecular docking calculations to identify binding modes of substrates (e.g., citric acid and malic acid)

  • Visualization of binding interactions using programs like PyMol

The most comprehensive studies typically combine these approaches, using structural predictions to guide mutagenesis experiments, followed by functional assays in reconstituted systems or cellular models.

What are the optimal expression systems for producing functional recombinant Slc25a1?

The selection of an appropriate expression system is crucial for obtaining functional recombinant Slc25a1. Based on research methodologies employed in studying transporters like Slc25a1, the following expression systems have demonstrated efficiency:

Bacterial Expression Systems (E. coli)

  • Advantages: High yield, cost-effective, rapid growth

  • Considerations: May require optimization of codon usage, inclusion body formation common, post-translational modifications limited

  • Recommended strains: BL21(DE3), C41(DE3), or C43(DE3) for membrane proteins

  • Purification approach: Typically employs affinity tags (His-tag) followed by size exclusion chromatography

Yeast Expression Systems

  • Advantages: Eukaryotic processing capabilities, higher likelihood of proper folding

  • Recommended species: Pichia pastoris or Saccharomyces cerevisiae

  • Expression strategy: Inducible promoters (e.g., AOX1 for P. pastoris) with secretion signals

Insect Cell Expression

  • Advantages: Advanced eukaryotic processing, suitable for complex membrane proteins

  • System components: Typically uses baculovirus expression vector system in Sf9 or Hi5 cells

  • Yield considerations: Generally lower than bacterial systems but higher protein quality

Mammalian Cell Expression

  • Advantages: Native-like post-translational modifications, proper folding environment

  • Recommended cell lines: HEK293 or CHO cells

  • Expression strategy: Transient or stable transfection approaches

How can researchers effectively design assays to measure Slc25a1 transport activity?

Designing effective assays to measure Slc25a1 transport activity requires careful consideration of several factors:

Radioactive Transport Assays

  • Substrate selection: Use of radioactive [14C] citrate as the primary substrate

  • Control conditions: Include "inhibitor-stop" controls by adding the inhibitor together with radioactive substrate at the start

  • Temperature optimization: Typically performed at 25°C for consistent kinetics

  • Separation methodology: Employ Sephadex G-75 to remove external radioactivity

  • Detection: Quantify using liquid scintillation analysis

Non-radioactive Alternative Approaches

  • Fluorescent substrate analogs: Modified citrate molecules with fluorescent tags

  • pH-sensitive probes: To detect proton movements that may accompany transport

  • Isothermal titration calorimetry: For direct measurement of binding affinities

  • Mass spectrometry: To track isotope-labeled substrates

Data Analysis Methods

  • Kinetic parameters: Determine Km and Vmax through linear regression analysis of transport data

  • Inhibition studies: Utilize competitive and non-competitive inhibitors to characterize transport mechanisms

  • Statistical validation: Apply appropriate statistical tests (typically ANOVA with post-hoc comparisons) to evaluate significance of results

Experimental Controls

Control TypePurposeImplementation
Negative ControlEstablish baselineEmpty liposomes or inhibitor pre-treatment
Substrate SpecificityConfirm transporter identityTest multiple substrates including non-substrates
Temperature DependenceVerify active transportCompare activity at different temperatures
Concentration GradientsEstablish directionalityTest various internal/external substrate ratios
Mutant VariantsStructure-function analysisTest transport activity of site-directed mutants

When designing these assays, it's critical to consider the native orientation of Slc25a1 in the mitochondrial membrane and replicate this orientation in reconstituted systems to accurately measure physiologically relevant transport activities.

What animal models are most appropriate for studying Slc25a1-related disorders?

The selection of appropriate animal models is crucial for investigating Slc25a1-related disorders and understanding the protein's physiological roles. Based on current research, several model systems have proven valuable:

Mouse Models

Mice with systemic knockout of Slc25a1 have been instrumental in revealing its role in development, particularly in cardiac morphogenesis . These models exhibit:

  • Impaired embryonic growth

  • Cardiac malformations

  • Mitochondrial ultrastructural defects

  • Altered metabolic gene expression profiles

For tissue-specific studies, conditional knockout models using Cre-loxP systems can target Slc25a1 deletion to specific tissues of interest, such as:

  • Adipocyte-specific knockouts for metabolic studies

  • Cardiomyocyte-specific knockouts for cardiac development research

  • Neuron-specific knockouts for neurological investigations

Zebrafish Models

Zebrafish offer several advantages for studying Slc25a1 function:

  • Transparency during development facilitates real-time observation

  • Rapid development allows for efficient phenotypic screening

  • Amenable to genetic manipulation through morpholino knockdown or CRISPR/Cas9 editing

Research has demonstrated that knockdown of SLC25A1 expression in zebrafish can mirror human disease phenotypes, including:

  • Variable brain, eye, and cardiac involvement

  • Clear abnormalities in neuromuscular junction development

  • Differential tissue sensitivities to Slc25a1 deficiency

Fungal Models

The oleaginous fungus Mucor circinelloides WJ11 has been used to study the tricarboxylate citrate transporter (Tct), providing insights into:

  • Structural characteristics of citrate transporters

  • Transport kinetics and substrate specificity

  • Molecular interactions during the transport process

While not directly modeling human disease, fungal systems offer simplified experimental platforms for fundamental studies of transporter function.

Comparative Model Characteristics

Model SystemAdvantagesLimitationsBest Applications
Mouse ModelsMammalian physiology, genetic tools available, organ systems similar to humansHigher cost, longer development timeDisease modeling, developmental studies, tissue-specific effects
ZebrafishRapid development, transparent embryos, ease of genetic manipulationEvolutionary distance from mammalsHigh-throughput screening, neuromuscular junction studies, developmental research
Cell CultureCost-effective, controlled environment, human cells can be usedLacks in vivo contextMolecular mechanisms, drug screening, protein-protein interactions
Fungal SystemsSimple manipulation, clear biochemical readoutsEvolutionary distance from mammalsBasic transporter function, structural studies

The selection of an appropriate model system should be guided by the specific research question, with consideration of the physiological context most relevant to the Slc25a1-related disorder being investigated.

What are the unresolved questions regarding Slc25a1's role in neurodevelopmental disorders?

Despite significant advances in understanding Slc25a1 function, several critical questions remain unresolved regarding its role in neurodevelopmental disorders:

  • Mechanistic pathways: While mutations in SLC25A1 are known to cause severe brain abnormalities in conditions like combined D,L-2-hydroxyglutaric aciduria, the precise molecular mechanisms linking citrate transport dysfunction to neurological manifestations remain incompletely understood .

  • Neuron-specific vulnerabilities: Research indicates that brain cells appear particularly vulnerable to Slc25a1 dysfunction, but the basis for this tissue-specific sensitivity requires further investigation .

  • Neuromuscular junction development: Evidence suggests that Slc25a1 plays a critical role in neuromuscular junction formation and function, but the detailed molecular pathways involved need clarification .

  • Genotype-phenotype correlations: The relationship between specific SLC25A1 mutations and the severity of neurological phenotypes shows considerable variability, with some mutations causing lethal phenotypes while others result in milder presentations primarily affecting neuromuscular function .

  • Therapeutic targets: Identifying potential intervention points within Slc25a1-dependent metabolic pathways that could ameliorate neurological manifestations remains a significant challenge.

Future research directions should focus on:

  • Developing neuron-specific conditional Slc25a1 knockout models

  • Investigating the role of Slc25a1 in neurotransmitter metabolism

  • Exploring the impact of Slc25a1 dysfunction on epigenetic regulation in neuronal cells

  • Characterizing the metabolic profile of Slc25a1-deficient neurons at single-cell resolution

  • Identifying compounds that could bypass the metabolic bottlenecks created by Slc25a1 dysfunction

How does post-translational regulation of Slc25a1 vary across different metabolic states?

The post-translational regulation of Slc25a1 across different metabolic states represents an evolving area of research with several key questions:

  • Phosphorylation dynamics: While phosphorylation at Threonine 155 by IRAKM has been identified as a critical regulatory mechanism in response to IL-1β stimulation, the complete landscape of Slc25a1 phosphorylation sites and responsible kinases under various metabolic conditions remains to be fully characterized .

  • Other post-translational modifications: Beyond phosphorylation, potential regulation through acetylation, ubiquitination, or other modifications has not been comprehensively investigated.

  • Metabolic sensor function: Evidence suggests that Slc25a1 activity responds to changing metabolic states, but the sensing mechanisms and integration with cellular energy status require further elucidation.

  • Tissue-specific regulation: Different tissues likely employ distinct regulatory mechanisms for Slc25a1 activity based on their metabolic priorities and challenges.

  • Circadian regulation: The potential for circadian control of Slc25a1 activity to coordinate with daily metabolic rhythms remains an intriguing possibility.

Current research indicates that in adipocytes, the IL-1R-IRAKM-Slc25a1 signaling axis represents a mechanism for inflammatory signals to modulate lipid metabolism . This suggests a complex integration of immune and metabolic signaling pathways centered on Slc25a1 regulation. Additional research is needed to determine how other physiological signals—such as insulin, glucagon, or catecholamines—might influence Slc25a1 activity in different tissues and metabolic states.

What therapeutic strategies targeting Slc25a1 show promise for metabolic and developmental disorders?

Based on current understanding of Slc25a1 function and its role in various disorders, several therapeutic strategies show potential:

  • Targeting the IL-1R-IRAKM-Slc25a1 axis: Research indicates that disrupting the interaction between IRAKM and Slc25a1 or developing specific IRAKM inhibitors could offer therapeutic benefits for obesity-related pathologies by reducing lipogenesis in adipose tissue .

  • Metabolic bypass strategies: For conditions involving Slc25a1 deficiency, approaches that provide alternative sources of cytosolic acetyl-CoA or citrate could potentially ameliorate some metabolic consequences.

  • Small molecule modulators: Development of compounds that can enhance the activity of partially functional Slc25a1 mutants might benefit patients with milder forms of Slc25a1-related disorders.

  • Gene therapy approaches: For severe genetic forms of Slc25a1 deficiency, targeted gene replacement strategies could potentially restore normal citrate transport function.

  • Dietary interventions: Modifications in citrate or lipid intake might help manage some symptoms in patients with Slc25a1 dysfunction, though this requires careful evaluation.

The therapeutic potential of targeting Slc25a1 is highlighted by research showing that kinase-inactive IRAKM reduced IL-1β-induced de novo fatty acid synthesis in adipocytes and decreased lipid accumulation in both white and brown adipose tissues from high-fat diet-fed mice, improving obesity-related pathophysiology . This suggests that pharmacological inhibition of the IRAKM-Slc25a1 interaction might represent a viable approach for treating obesity and metabolic syndrome.

For developmental disorders linked to Slc25a1 dysfunction, early intervention strategies based on a thorough understanding of the affected metabolic pathways will be crucial for mitigating developmental impacts, particularly on the nervous system and heart.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.