Recombinant Rat Tumor necrosis factor ligand superfamily member 6 (Faslg)

Shipped with Ice Packs
In Stock

Description

Biological Functions

Mechanisms of Action

  1. Apoptosis Induction:

    • Binds Fas receptor (TNFRSF6), triggering DISC formation and caspase activation .

    • Critical for T-cell homeostasis and immune privilege .

  2. Reverse Signaling:

    • Costimulates proliferation in antigen-activated T cells .

  3. Proinflammatory Role:

    • Acts as chemoattractant for neutrophils in TGF-β-deficient environments .

Regulatory Interactions

Binding PartnerEffect
Fas/CD95Apoptosis initiation
DcR3 (Decoy Receptor)Inhibits apoptosis
MetalloproteinasesGenerates less-active sFasL
Data from R&D Systems

Research Applications

Experimental Use Cases

  • Autoimmune Disease Models:
    Used to study lymphoproliferative disorders mimicking human ALPS (Autoimmune Lymphoproliferative Syndrome) .

  • Cancer Immunology:

    • Investigates tumor immune evasion via FasL-mediated lymphocyte apoptosis .

    • Combined with checkpoint inhibitors in therapeutic studies .

  • Transplantation Research:
    Assesses FasL role in transplant arteriosclerosis and immune tolerance .

Key Assay Systems

Assay TypeProtocol Highlights
Cytotoxicity (Jurkat)ED₅₀: 1–3 ng/mL with cross-linker
Flow CytometryAF1858 antibody validation
In Vivo InflammationNeutrophil migration studies

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, kindly indicate your preference in the order notes, and we will fulfill your request accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery estimates, we recommend contacting your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol final concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer composition, temperature, and protein stability. Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C, while the lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during the production process. If you have a preferred tag type, please inform us, and we will prioritize developing it for you.
Synonyms
Faslg; Apt1Lg1; Cd95l; Fasl; Tnfsf6; Tumor necrosis factor ligand superfamily member 6; CD95 ligand; CD95-L; Fas antigen ligand; Fas ligand; FasL; CD antigen CD178
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-278
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MQQPVNYPCPQIYWVDSSATSPWAPPGSVFSCPSSGPRGPGQRRPPPPPPPPSPLPPPSQPPPLPPLSPLKKKDNIELWLPVIFFMVLVALVGMGLGMYQLFHLQKELAELREFTNHSLRVSSFEKQIANPSTPSETKKPRSVAHLTGNPRSRSIPLEWEDTYGTALISGVKYKKGGLVINEAGLYFVYSKVYFRGQSCNSQPLSHKVYMRNFKYPGDLVLMEEKKLNYCTTGQIWAHSSYLGAVFNLTVADHLYVNISQLSLINFEESKTFFGLYKL
Uniprot No.

Target Background

Function
Tumor necrosis factor ligand superfamily member 6 (Faslg), also known as Fas ligand, is a cytokine that binds to TNFRSF6/FAS, a receptor that transduces the apoptotic signal into cells. It plays a significant role in cytotoxic T-cell-mediated apoptosis, natural killer cell-mediated apoptosis, and T-cell development. Faslg initiates fratricidal/suicidal activation-induced cell death (AICD) in antigen-activated T-cells, contributing to the termination of immune responses. TNFRSF6/FAS-mediated apoptosis also plays a role in the induction of peripheral tolerance. Faslg binds to TNFRSF6B/DcR3, a decoy receptor that blocks apoptosis. Additionally, it induces FAS-mediated activation of NF-kappa-B, initiating non-apoptotic signaling pathways. While Faslg can induce apoptosis, it appears not to be essential for this process. Its cytoplasmic form can induce gene transcription inhibition.
Gene References Into Functions

References:

  1. MiR-411 mimic inhibited oxygen-glucose deprivation - induced PC12 cell apoptosis, possibly via directly targeting FasL. PMID: 29738767
  2. The expression of apoptosis-related genes Fas and FasL in rats with an experimentally induced left-side varicocele was significantly increased compared to that in the control group. PMID: 28722192
  3. Hepatitis B virus X protein modulates apoptosis in tubule renal cells and activates Fas/FasL through the MLK3-MKK7-JNK3 signaling pathway. PMID: 27606894
  4. PEDF inhibits angiogenesis in the heart by inducing tip cells apoptosis via up-regulating PPARG to increase surface FasL. PMID: 26519036
  5. Up-regulated FasL pathways mediating differentiation. PMID: 25428397
  6. These results indicate that chorionic gonadotropin promotes follicular development via downregulation of death-inducer Fas/FasL expression and promotion of ovarian cell proliferation. PMID: 25294749
  7. Sulforafan inhibited galactosamine/lipopolysaccharide induced caspase-3 activation and suppressed FAS and FASL expression. PMID: 25439027
  8. CCN1, often co-expressed with FasL in a stressed heart, sensitizes cardiomyoblasts to FasL-induced apoptosis. PMID: 24631528
  9. pTREFasLcHS4V16 with an improved tet-on system can precisely regulate the expression of FasL gene and apoptosis for arthritis treatment. PMID: 21792649
  10. Results of the study indicate a time-dependent increase in the mRNA levels of Fas Ligand (FasL) and phosphatase and tensin homologue deleted on chromosome 10 (PTEN) up until 6 h after death. PMID: 24297385
  11. This study showed increase in the C-fibre response and an upregulation of the gene expression of Fasl 180 minutes after application of NP onto the nerve roots PMID: 23711477
  12. Cerebral ischemia/reperfusion mediates procaspase-3 denitrosylation and activation through GluR6-FasL-Trx2 pathway, which leads to neuronal apoptosis and cell death. PMID: 23949220
  13. The Fas/Fas ligand death receptor pathway contributes to phenylalanine-induced apoptosis. PMID: 23940767
  14. Prolonged mechanical ventilation induces apoptosis of alveolar type II cells in newborn rats via the extrinsic death pathway and the FasL/Fas system. PMID: 23934924
  15. Overexpression of SIRT1 up-regulates FasL expression in both flow-restricted mouse carotid arteries and serum-stimulated vascular smooth muscle cell. PMID: 23806367
  16. Hypoxia causes the upregulation of FasL expression but the downregulation of miR-21 expression in microglia. PMID: 22907769
  17. Soluble FasL is locally produced in the chronically inflamed testis. PMID: 22892327
  18. FasL governs the immunoregulatory property of dental pulp stem cells in the context of inducing T-cell apoptosis. PMID: 22904205
  19. In summary, the Fas/FasL pathway involved in alveolar epithelial cell apoptosis could be important in the pathogenesis of seawater-induced acute lung injury PMID: 22609371
  20. Carbon disulfide causes apoptosis of sertoli cells and increases expression of FasL. PMID: 17241545
  21. Data suggest the potential therapeutic applications for suppression of rheumatoid arthritis (RA) by local joint delivery of CTLA4-FasL. PMID: 22354915
  22. Endothelial cells with expression of FasL or viruses recombinant with FasL gene transfusion can preserve liver function and prolong the survival time of liver allografts. PMID: 22664023
  23. observations indicate that CTLA4-FasL protein represents a significantly suppressive effect on inflammatory fibroblast-like synoviocytes' proliferation PMID: 22325471
  24. Fluorofenidone significantly reduced Ang II-induced increases in Fas, FasL at the mRNA level. PMID: 21586345
  25. analysis of of functionally active Fas ligand interfering protein (FIP) PMID: 18204739
  26. Apoptosis mediated by Fas/FasL may play an important role in the pathogenesis of acute liver injury. PMID: 16831245
  27. overexpression of miR-21 protects against ischemic neuronal death, and that downregulation of FASLG, an important cell death-inducing ligand whose gene is targeted by miR-21, probably mediates the neuroprotective effect PMID: 20840605
  28. The reverse transcriptase polymerase chain reaction demonstrated Fas gene expression in liver and renal tissues at 1 hour after liver transplantation. PMID: 20620473
  29. Se deficiency can lead to over expression of Fas/FasL. PMID: 19239001
  30. p,p'-DDE could induce DNA damage and FasL gene expression of Sertoli cells of rat testis. PMID: 16921742
  31. down-regulating FasL expression and/or function in glial malignancies can enhance T-cell tumor infiltration and inhibit tumor growth PMID: 20406899
  32. Resveratrol treatment significantly increased the apoptotic indices of pancreatic acinar cells and the levels of FasL mRNA and protein in rats with severe acute pancreatitis. PMID: 19304523
  33. Fas/FasL system may function as a possible mechanism mediating estrogen-induced apoptosis in the thymus. The present data demonstrate...Fas/FasL system could play an important role maintaining this balance as the mediators of programmed cell death. PMID: 11642679
  34. Corticotropin-releasing hormone induces Fas ligand production and apoptosis in PC12 cells via activation of p38 mitogen-activated protein kinase PMID: 11790788
  35. Notch3 signaling in vascular smooth muscle cells induces c-FLIP expression via ERK/MAPK activation. Resistance to Fas ligand-induced apoptosis PMID: 11925448
  36. Mitochondrial oxidative stress and CD95 ligand: a dual mechanism for hepatocyte apoptosis in chronic alcoholism. PMID: 11981771
  37. Oxidative stress is a major stimulus in eliciting Fas and FasL expression in NGF-differentiated PC12 cells. Moreover, we describe here for the first time the existence of cAMP-dependent mechanism(s) modulating Fas and FasL expression. PMID: 12111799
  38. findings support the hypothesis that the expression of FasL in normal ovary is hormonally sensitive PMID: 12113885
  39. Hyperosmotic hepatocyte shrinkage induces CD95 trafficking to the plasma membrane, which involves JNK-, PKA-, and PKC-dependent mechanisms and sensitizes hepatocytes toward CD95L-mediated apoptosis. PMID: 12198652
  40. The consequences of FasL overexpression depend on the subcellular compartment and species in which FasL enforced expression is targeted and this is at least partially related to FLIP levels PMID: 12477972
  41. The results suggest that recruitment of preformed FasL from intracellular compartments, rather than its biosynthesis, is responsible for the increase in FasL on the cell surface following IFN-gamma stimulation. PMID: 12904679
  42. downregulation of Akt signalling and activation of Forkhead is a prerequisite for the induction of FasL promoter PMID: 14576824
  43. CD95 ligand-induced CD95 activation in rat hepatocytes is inhibited by CD95-tyrosine nitration PMID: 14679192
  44. FasL expression in rat testis is present from the early postnatal days up to the adult, and the Sertoli cells is the main FasL expressing cell within the seminiferous tubule. PMID: 15379972
  45. Fas ligand is not detected in the notochord. During intervertebral disc formation, Fas ligand is expressed in the nucleus pulposus. The disc's immune privilege may begin early in disc formation. Fas ligand may play an important role in disc formation. PMID: 15507796
  46. NO inhibited Fas/FasL system-induced apoptosis by suppressing activation of the caspases, pointing to a cross-talk between Fas/FasL system-induced apoptosis pathway and NO-mediated antiapoptotic pathway in ovarian follicle atresia. PMID: 15528299
  47. FasL protein expression was localized to caveolae membrane domains PMID: 15541714
  48. Acute pancreatitis induces liver injury and hepatocyte death while up-regulating FasL, p38-MAPK, and caspase-3. Fas is up-regulated within Kupffer cells, suggesting that FasL may autoregulate its production by inducing its originator-cell death. PMID: 15555619
  49. METH causes some of its neurodegenerative effects, in part, via stimulation of the Fas-mediated cell death pathway consequent to FasL up-regulation mediated by activation of multiple TFs. PMID: 15644446
  50. Mitochondria-derived ROS and calcium play a key role in stimulating DOX-induced 'intrinsic and extrinsic forms' of apoptosis in cardiac cells with Fas L expression via the NFAT signalling mechanism. PMID: 15799720

Show More

Hide All

Database Links

KEGG: rno:25385

STRING: 10116.ENSRNOP00000003998

UniGene: Rn.9725

Protein Families
Tumor necrosis factor family
Subcellular Location
Cell membrane; Single-pass type II membrane protein. Cytoplasmic vesicle lumen. Lysosome lumen.; [Tumor necrosis factor ligand superfamily member 6, soluble form]: Secreted.; [FasL intracellular domain]: Nucleus.
Tissue Specificity
Expressed in activated splenocytes and thymocytes. Moderate or weak expression found in small intestines, kidney and lung.

Q&A

What is the molecular structure of rat Faslg and how does it compare to human Faslg?

Rat Faslg is a 40 kDa type II transmembrane protein belonging to the TNF superfamily. The mature rat Fas Ligand consists of a 179 amino acid extracellular domain (ECD), a 22 amino acid transmembrane segment, and a 79 amino acid cytoplasmic domain. The rat Faslg protein is encoded by UniProt ID P36940.

Within the extracellular domain, rat Faslg shares 78% amino acid sequence identity with human Faslg and 93% with mouse Faslg . This high level of conservation suggests functional similarity across species, although species-specific differences in activity should be considered when designing cross-species experiments.

Structurally, Faslg exists as a non-disulfide-linked homotrimer on the cell surface of activated immune cells, particularly CD4+ Th1 cells, CD8+ cytotoxic T cells, and NK cells .

What are the primary functions of Faslg in normal physiological conditions?

Recombinant rat Faslg has several key physiological functions:

  • Apoptosis induction: Primarily known for triggering programmed cell death in Fas-expressing cells by binding to the Fas receptor (CD95/APO-1), forming the Death-Inducing Signaling Complex (DISC) .

  • Immune homeostasis: Central to the activation-induced death of T lymphocytes that terminates immune reactions, preventing excessive inflammation .

  • Maintenance of immune privilege: Contributes to the protection of certain tissues (e.g., cornea, testis) by inducing apoptosis in infiltrating Fas-bearing lymphocytes and inflammatory cells .

  • Reverse signaling: Transmits signals back to the Faslg-expressing cell, which can costimulate the proliferation of freshly antigen-stimulated T cells .

  • Transcriptional regulation: The FasL intracellular domain (FasL ICD) cytoplasmic form can induce gene transcription inhibition .

What are the most reliable methods for detecting rat Faslg in biological samples?

Several validated methods exist for detecting rat Faslg in biological samples, each with specific advantages:

  • ELISA (Enzyme-Linked Immunosorbent Assay):

    • Sandwich ELISA is the most common quantitative method for detecting rat Faslg in cell culture supernatants, serum, and plasma (heparin, EDTA, citrate) .

    • Detection range typically spans 31.2-2000 pg/mL with sensitivity <10 pg/mL .

    • Intra-assay CV: approximately 4.5%; Inter-assay CV: approximately 7.6% .

  • Immunohistochemistry/Immunofluorescence:

    • Useful for tissue localization studies.

    • Example protocol: Incubation with anti-rat Fas Ligand/TNFSF6 antigen affinity-purified polyclonal antibody (15 µg/mL) for 3 hours at room temperature, followed by fluorophore-conjugated secondary antibody .

  • Western Blotting:

    • Caution needed with antibody selection due to documented specificity issues with some antibodies (e.g., clone 33) .

    • Recommended: Use multiple antibodies and validate with appropriate positive and negative controls.

  • Flow Cytometry:

    • Valuable for detecting membrane-bound Faslg on cell surfaces.

    • Non-denaturing conditions preserve the native structure of Faslg.

It's important to note that antibody selection is crucial, as documented specificity issues exist with certain antibodies. For instance, clone 33 has been shown to recognize cross-reactive proteins under denaturing conditions, leading to potential false-positive identification .

How should recombinant rat Faslg be stored and handled to maintain optimal activity?

Proper storage and handling of recombinant rat Faslg is critical for maintaining its biological activity:

Storage Recommendations:

  • Lyophilized form: 12 months at -20°C to -70°C .

  • Liquid form: 6 months at -20°C to -80°C .

  • Reconstituted protein: 1 month at 2-8°C under sterile conditions, or 6 months at -20°C to -70°C under sterile conditions .

Handling Guidelines:

  • Avoid repeated freeze-thaw cycles as this significantly reduces activity .

  • When shipping, use wet ice for short-term transport .

  • For reconstitution, use sterile PBS at a recommended concentration of 100 μg/mL .

  • After reconstitution, prepare working aliquots to minimize freeze-thaw cycles.

  • Some formulations contain carrier proteins (e.g., BSA) to enhance stability and increase shelf-life, allowing storage at more dilute concentrations .

Activity Considerations:
When testing bioactivity, note that the ED50 of recombinant rat Fas ligand effects (e.g., cytotoxicity) is typically in the range of 0.05-0.25 µg/mL in the presence of appropriate cross-linking antibodies .

How do soluble and membrane-bound forms of Faslg differ in their biological activities?

The biological activities of soluble and membrane-bound Faslg exhibit significant differences that are important to consider in experimental design:

Membrane-bound Faslg:

  • The primary active form for inducing robust apoptosis in Fas-expressing cells .

  • Forms as a non-disulfide-linked homotrimer on the cell surface .

  • Crucial for immune cell deletion and maintenance of immune privilege sites .

Soluble Faslg (sFasL):

  • Generated by metalloproteinase-mediated cleavage from the cell surface, resulting in a 26 kDa molecule that remains trimeric .

  • Retains Fas binding ability but demonstrates dramatically reduced apoptosis-inducing capacity compared to membrane-bound form .

  • Can promote inflammation rather than cell death, particularly in the absence of TGF-beta .

  • Associated with inflammatory disease progression and severity in certain contexts, such as COVID-19 and SLE .

  • May act through alternative receptors beyond Fas, such as DR5 (encoded by TNFRSF10B), particularly in inflammatory conditions .

This functional dichotomy is critically important when designing experiments with recombinant Faslg. Research has shown that recombinant soluble FasL often requires additional cross-linking (e.g., with anti-polyHistidine antibodies) to effectively induce apoptosis in vitro . The ED50 for cell death induction is typically 0.3-1.5 ng/mL in the presence of 10 µg/mL of a cross-linking antibody .

What are the available animal models for studying Faslg-mediated pathology, and what are their limitations?

Several animal models exist for studying Faslg-mediated pathology, each with specific advantages and limitations:

1. Fas/FasL mutation models:

  • lpr mice (lymphoproliferation): Carry a mutation in the Fas gene, resulting in defective Fas expression. These mice develop lymphadenopathy by accumulating abnormal T cells and suffer from systemic lupus erythematosus-like autoimmune disease .

  • gld mice (generalized lymphoproliferative disease): Carry a Fas Ligand point mutation that causes severe lymphoproliferation and systemic autoimmunity .

  • NEMO^Δhepa/Fas^lpr mice: A model combining hepatocyte-specific NEMO deletion with Fas mutation, used to study chronic liver disease progression and hepatocellular carcinoma .

2. Disease-specific models:

  • Antigen-induced arthritis (AIA): Used to study sFasL-mediated inflammation in autoimmune arthritis .

  • MA20 SARS-CoV-2 model: A mouse-adapted SARS-CoV-2 model that recapitulates key pathological features of COVID-19, showing increased FasL expression on inflammatory monocytic macrophages and NK cells in infected mouse lungs .

Limitations:

  • Systemic effects: Global Fas/FasL mutations lead to widespread immune dysregulation, complicating the isolation of tissue-specific pathology.

  • Compensatory mechanisms: Long-term deficiency may trigger alternative pathways.

  • Strain-specific differences: Background strain can significantly influence phenotype severity.

  • Translation challenges: Species-specific differences in pathway regulation between rodents and humans.

When designing studies using these models, researchers should carefully consider the background strain, age of the animals, and specific readouts for FasL activity.

How does Faslg interact with other members of the TNF superfamily in signaling networks?

Faslg functions within a complex network of TNF superfamily members, with significant cross-talk and functional overlap:

Key interactions and pathway overlaps:

  • FasL and TRAIL signaling convergence:

    • Both FasL (binding to Fas) and TRAIL (binding to TRAIL-R1/R2) can activate similar downstream pathways leading to apoptosis via FADD recruitment and DISC formation .

    • Intriguingly, research has identified that FasL can also bind to DR5 (TRAIL-R2), creating a non-canonical signaling pathway in certain inflammatory conditions .

    • Competitive binding studies show that preincubation with recombinant human TRAIL or FasL can inhibit FasL-Fc protein binding to human fibroblast-like synoviocytes (FLSCs) and DR5-expressing cells .

  • Decoy receptor modulation:

    • DcR3 acts as a soluble decoy receptor that can bind to FasL, preventing its interaction with Fas and inhibiting apoptosis .

    • DcR3 also binds to other TNF family ligands including LIGHT and TL1, demonstrating the significant cross-regulation within this family .

  • Shared downstream signaling components:

    • Both TRAIL and FasL signaling pathways converge on similar components of the death-inducing signaling complex (DISC).

    • The activated receptor recruits the adaptor molecule FADD to form the DISC, which then activates the caspase cascade leading to apoptosis .

Understanding these interactions is critical when designing experiments with recombinant Faslg, as the presence of other TNF family members or decoy receptors in the experimental system may significantly impact observed outcomes.

What are the primary antibody specificity issues when working with rat Faslg, and how can they be addressed?

Antibody specificity represents a significant challenge in Faslg research, with documented issues that can lead to erroneous results:

Known specificity issues:

The most well-documented problem involves clone 33 anti-FasL antibody (Transduction Laboratories/Pharmingen/Becton Dickinson), which has been shown to:

  • Recognize a non-FasL protein of approximately 37 kDa under denaturing conditions, leading to false positive identification of FasL in Western blots .

  • Bind to FasL under certain non-denaturing conditions such as immunoprecipitation, but with significantly lower affinity than to the cross-reactive protein .

  • Continue to be used in research despite these documented specificity issues .

Recommendations for addressing antibody specificity concerns:

  • Use multiple detection methods: Combine techniques (e.g., Western blot, flow cytometry, immunoprecipitation) to corroborate findings.

  • Include proper controls:

    • Positive controls: Cells/tissues known to express Faslg

    • Negative controls: Faslg knockout samples or cells without Faslg expression

    • Antibody controls: Isotype controls and pre-absorption with recombinant Faslg

  • Cross-validate with multiple antibodies: Use antibodies from different sources that recognize distinct epitopes.

  • Consider alternative detection methods: When possible, use functional assays or mRNA detection (RT-PCR, Northern blot) to complement protein detection.

  • Verify by immunodepletion: Pre-absorb antibodies with recombinant Faslg to confirm specificity.

  • Follow validated protocols: For example, when detecting Faslg in rat splenocytes by immunofluorescence, a validated protocol uses goat anti-rat Fas Ligand/TNFSF6 antigen affinity-purified polyclonal antibody at 15 µg/mL for 3 hours at room temperature, followed by appropriate secondary antibody staining .

What factors affect the bioactivity of recombinant rat Faslg in cell-based assays?

Several critical factors can significantly impact the bioactivity of recombinant rat Faslg in experimental settings:

1. Cross-linking requirements:

  • Soluble recombinant FasL often requires cross-linking to effectively induce apoptosis.

  • The ED50 for cell death effects typically ranges from 0.3-1.5 ng/mL in the presence of 10 µg/mL of a cross-linking antibody (e.g., anti-polyHistidine monoclonal antibody) .

  • For rat Faslg specifically, an ED50 of 0.05-0.25 µg/mL has been reported in the presence of 100 ng/mL recombinant rat Fas Ligand .

2. Target cell factors:

  • Fas receptor expression levels on target cells

  • Intracellular apoptotic machinery integrity

  • Activation state of target cells (activated T cells are more susceptible)

  • Expression of anti-apoptotic proteins (e.g., c-FLIP, Bcl-2 family members)

3. Assay conditions:

  • Incubation time: Typically 6-24 hours for apoptosis assays

  • Cell density: Overcrowding can affect results

  • Serum factors: Some serum components may interfere with FasL-Fas interactions

  • Presence of metalloproteinase inhibitors: May prevent cleavage of membrane-bound FasL

  • Temperature and pH: Optimal activity at physiological conditions (37°C, pH 7.2-7.4)

4. Recombinant protein characteristics:

  • Presence/absence of carrier proteins (BSA can enhance stability)

  • Glycosylation status (affects stability and receptor binding)

  • Storage conditions and freeze-thaw cycles

  • Tag position and type (His-tag, Fc-fusion, etc.)

Troubleshooting low bioactivity:

  • Verify target cell Fas expression

  • Increase cross-linking antibody concentration

  • Use freshly prepared recombinant protein

  • Consider alternative target cells with known Fas sensitivity

  • Verify recombinant protein integrity by SDS-PAGE

How is Faslg involved in the pathophysiology of COVID-19 and other inflammatory diseases?

Recent research has identified Faslg as a critical factor in several inflammatory diseases, with notable developments in COVID-19 pathophysiology:

Faslg in COVID-19:
A 2024 study published in Cell Death & Differentiation identified FasL as a crucial host factor driving the immunopathology underlying COVID-19 severity and mortality . Key findings include:

  • Significant increases in FasL expression on inflammatory monocytic macrophages and NK cells in the lungs of mouse-adapted SARS-CoV-2 (MA20) infected mice.

  • Therapeutic FasL inhibition markedly increased survival rates in both young and old MA20-infected mice, coinciding with substantially reduced cell death and inflammation in lung tissue.

  • Elevated FasL levels were detected in bronchoalveolar lavage fluid of critically ill COVID-19 patients, suggesting clinical relevance.

These findings suggest that FasL-mediated cell death contributes significantly to the dysregulated immune response and lung failure in severe COVID-19.

Faslg in autoimmune diseases:

  • Arthritis: Soluble Fas ligand (sFasL) has been shown to drive autoantibody-induced arthritis by binding to DR5 rather than Fas, representing a non-canonical pathway. This suggests that sFasL-mediated inflammation may be regulated through alternative receptors in vivo .

  • Systemic Lupus Erythematosus (SLE): A 2020 study published in Lupus Science & Medicine demonstrated that serum soluble FasL levels are associated with organ damage accrual in SLE patients, independent of B cell-activating factor (BAFF) levels. The serum sFasL/sFas ratio was proposed as a potential biomarker for disease activity .

  • Liver disease: Research using NEMO^Δhepa/Fas^lpr mice has shown that disruption of FasL/Fas signaling protects against inflammation-driven tumorigenesis in experimental models of chronic liver disease, suggesting a potential therapeutic approach for hepatocellular carcinoma .

These findings collectively position Faslg as a potential therapeutic target in various inflammatory and autoimmune conditions, with inhibition of FasL potentially beneficial for reducing tissue damage and improving disease outcomes.

What are the challenges in developing Faslg as a therapeutic target for cancer and autoimmune diseases?

Despite promising preclinical data, developing Faslg-targeted therapeutics presents several significant challenges:

1. Dual functional nature of Faslg:

  • Faslg exhibits both pro-apoptotic and pro-inflammatory effects depending on context .

  • The membrane-bound form primarily drives apoptosis while the soluble form can promote inflammation .

  • Therapeutic modulation must account for this duality to avoid unintended consequences.

2. Cross-talk with other TNF family members:

  • Overlap between Faslg and TRAIL signaling pathways complicates selective targeting .

  • Non-canonical binding of Faslg to receptors like DR5 suggests complex pathway interactions .

  • Decoy receptors like DcR3 can bind multiple ligands, affecting specificity of therapeutic approaches .

3. Translational challenges from animal models:

  • The gld and lpr mouse models, while informative, have systemic immune dysregulation that complicates interpretation .

  • Species-specific differences in pathway regulation between rodents and humans.

  • Context-dependency of Faslg effects across different tissues and disease states.

4. Cancer immunotherapy considerations:

  • Early hopes for TRAIL receptor agonists as cancer therapeutics produced disappointing clinical results, despite promising preclinical data .

  • Tumor cells can exploit Faslg expression to evade immune surveillance by killing tumor-infiltrating lymphocytes .

  • Patient stratification may be necessary to identify those most likely to respond to Faslg pathway modulation.

5. Technical challenges in therapeutic development:

  • Achieving tissue-specific targeting

  • Managing systemic effects on immune system

  • Developing antibodies with appropriate agonist or antagonist properties

  • Balancing immune activation versus immunosuppression

Future research directions should focus on better understanding tissue-specific roles of Faslg, identifying biomarkers for patient stratification, and developing more selective targeting strategies that account for the dual nature of Faslg signaling.

How should control experiments be designed when studying Faslg-mediated effects?

Rigorous control experiments are essential for accurately interpreting Faslg-mediated effects in research:

Basic control strategies:

  • Positive and negative controls for Faslg expression:

    • Positive: Cell lines with confirmed Faslg expression (e.g., activated T cells, NK cells)

    • Negative: Cell lines lacking Faslg expression or Faslg-knockout cells

  • Antibody specificity controls:

    • Isotype control antibodies

    • Pre-absorption with recombinant Faslg protein

    • Multiple antibodies targeting different epitopes

    • When using clone 33 antibody, additional validation is essential due to documented cross-reactivity issues

  • Functional assay controls:

    • Fas-deficient target cells (e.g., from lpr mice) to confirm Fas dependency

    • Blocking antibodies against Fas or Faslg

    • Caspase inhibitors (e.g., z-VAD-fmk) to confirm apoptotic mechanisms

    • Soluble Fas-Fc to neutralize Faslg activity

Advanced experimental design considerations:

  • Cross-linking controls for recombinant Faslg:

    • Include conditions with and without cross-linking antibodies

    • Titrate cross-linking antibody concentrations

    • Example: When testing recombinant human Faslg, the ED50 is typically 0.3-1.5 ng/mL in the presence of 10 µg/mL cross-linking antibody

  • Alternative receptor engagement:

    • Include controls for potential binding to non-Fas receptors like DR5

    • Consider using receptor-specific knockout cells or blocking antibodies

  • Soluble versus membrane-bound Faslg:

    • Use metalloproteinase inhibitors to prevent cleavage of membrane-bound Faslg

    • Compare effects of soluble recombinant Faslg versus cell-expressed Faslg

  • Time-course and dose-response analyses:

    • Include multiple time points to capture both early and late effects

    • Perform dose-response studies to determine optimal concentration ranges

  • Species compatibility considerations:

    • When mixing components from different species, verify cross-species activity

    • Remember that while both mouse and human Faslg are active on cells from either species, potency may differ

What methodological approaches can address data contradictions in Faslg research?

Data contradictions are common in Faslg research due to its complex biology and technical challenges. Here are methodological approaches to address these issues:

1. Standardization of experimental conditions:

  • Use consistent cell types, passage numbers, and culture conditions

  • Standardize recombinant protein sources and preparation methods

  • Define precise experimental parameters (timing, doses, readouts)

  • Document detailed methodologies to enable reproduction

2. Multi-method validation approaches:

  • Employ complementary techniques to verify findings:

    • Combine protein detection (Western blot, ELISA, flow cytometry) with mRNA analysis (RT-PCR, RNA-seq)

    • Validate antibody-based findings with functional assays

    • Use both in vitro and in vivo approaches when possible

3. Addressing antibody specificity issues:

  • The controversy surrounding clone 33 anti-Faslg antibody illustrates how antibody specificity can lead to contradictory results

  • Resolution strategies:

    • Use multiple antibodies targeting different epitopes

    • Perform careful antibody validation studies including knockout controls

    • Consider alternative detection methods that don't rely on antibodies

4. Managing soluble vs. membrane-bound Faslg contradictions:

  • The distinct and sometimes opposing functions of soluble versus membrane-bound Faslg can lead to contradictory findings

  • Resolution approaches:

    • Clearly distinguish which form is being studied

    • Use systems that allow selective expression or detection of each form

    • Consider the role of metalloproteinases in generating soluble Faslg

5. Receptor complexity considerations:

  • The discovery that Faslg can bind alternative receptors like DR5 adds complexity

  • Resolution strategies:

    • Test for binding to multiple receptors

    • Use receptor-specific knockout or knockdown approaches

    • Consider potential cross-talk between signaling pathways

6. Cross-laboratory validation and blinded analyses:

  • Collaborate with independent laboratories to verify key findings

  • Implement blinded analysis of samples and data to reduce bias

  • Participate in standardization initiatives or ring studies when available

7. Statistical rigor and transparency:

  • Use appropriate statistical methods for the experimental design

  • Report all data including negative results

  • Consider pre-registration of experimental designs for critical studies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.