Recombinant Rat Tumor necrosis factor receptor superfamily member 4 (Tnfrsf4)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Immune Regulation

Tnfrsf4/OX40 interacts with its ligand (OX40L/TNFSF4) to modulate T cell responses:

Co-Stimulatory Signaling

  • T Cell Activation: Upregulated on CD4⁺ and CD8⁺ T cells after TCR engagement, enhancing survival, proliferation, and cytokine production (e.g., IL-2, IFN-γ) .

  • Treg Regulation: Constitutively expressed on regulatory T cells (Tregs), promoting IL-2 sensitivity and proliferation while reducing suppressive activity .

  • Memory T Cell Maintenance: Prevents conversion of effector T cells to Tregs and sustains memory T cell responses .

Disease Pathophysiology

Disease ModelRole of OX40Source
Autoimmune DiseasesDrives Th1/Th2 responses in models like EAE and CIA; promotes CNS inflammation
Allergic Airway InflammationMediates IL-33-driven Treg and Th2 cell expansion in lungs; critical for type 2 immunity
Graft-Versus-Host DiseaseEnhances alloreactive T cell responses

Recombinant Protein Applications

Recombinant Rat Tnfrsf4 is used in:

Experimental Assays

  • Binding Studies: Recombinant OX40L binds to immobilized OX40 with an ED₅₀ of 0.25–1.5 ng/mL .

  • SDS-PAGE Analysis: Under reducing conditions, His-tagged OX40 migrates as 40–44 kDa (human) or 43–50 kDa (rat) .

Therapeutic Targeting

  • Agonist/Antagonist Screening: Fc-chimera proteins (e.g., Rat OX40/TNFRSF4 Fc) enable functional studies of OX40-OX40L interactions .

  • Cancer Immunotherapy: Preclinical models explore OX40 agonists to enhance anti-tumor T cell responses .

IL-33-Dependent Type 2 Immunity

  • Treg Expansion: OX40 is essential for IL-33-induced Treg proliferation in lungs, critical for helminth/allergen responses .

  • Th2 Cell Development: OX40 signaling licenses Th2 differentiation via OX40L upregulation on APCs .

T Cell-Dependent B Cell Responses

  • B Cell Activation: Tnfrsf4 knockout mice show impaired T cell-dependent B cell proliferation and antibody class-switching .

Comparative Analysis: Human vs. Rat Recombinant OX40

FeatureHuman OX40Rat OX40
ECD Sequence Identity63% with rat OX4090% with mouse OX40, 63% with human OX40
GlycosylationHigh (40–44 kDa on SDS-PAGE)Moderate (43–50 kDa due to glycosylation)
Typical FormulationHis-tag or Fc chimeras (e.g., 8584-OX)His-tag (e.g., OX0-R52H9) or Fc chimeras (e.g., 8584-OX)
Key ApplicationsCancer immunotherapy, autoimmune disease modelingAutoimmune/allergic disease studies, Treg biology

Challenges and Considerations

  • Structural Heterogeneity: Glycosylation impacts migration patterns in SDS-PAGE .

  • Species-Specific Effects: Human OX40 agonists may not translate directly to rat models due to sequence divergence .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All protein shipments are standardly sent with blue ice packs. For dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
Tnfrsf4; Ox40; Txgp1l; Tumor necrosis factor receptor superfamily member 4; MRC OX40; OX40 antigen; OX40L receptor; CD antigen CD134
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
20-271
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
VTVKLNCVKDTYPSGHKCCRECQPGHGMVSRCDHTRDTVCHPCEPGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTEDTVCQCRPGTQPRQDSSHKLGVDCVPCPPGHFSPGSNQACKPWTNCTLSGKQIRHPASNSLDTVCEDRSLLATLLWETQRTTFRPTTVPSTTVWPRTSQLPSTPTLVAPEGPAFAVILGLGLGLLAPLTVLLALYLLRKAWRSPNTPKPCWGNSFRTPIQEEQTDTHFTLAKI
Uniprot No.

Target Background

Function
Tumor necrosis factor receptor superfamily member 4 (TNFRSF4), also known as OX40, is a receptor for TNFSF4/OX40L/GP34. It serves as a costimulatory molecule involved in long-term T-cell immunity.
Gene References Into Functions
  1. OX40 and OX40L may play a role in the pathogenesis of experimental allergic neuritis. PMID: 20871162
  2. Ox40-Ox40 ligand is a critical pathway in alloimmune responses, particularly in recall/primed responses, and acts synergistically with CD28-B7 in mediating T cell effector responses during allograft rejection. PMID: 12626546
Database Links
Subcellular Location
Membrane; Single-pass type I membrane protein.
Tissue Specificity
Activated T-cells.

Q&A

What is TNFRSF4 and what is its role in immune function?

TNFRSF4 (OX40/CD134) is a co-stimulatory molecule belonging to the tumor necrosis factor receptor superfamily. It functions as a critical regulator in the immune system, particularly in T cell responses. TNFRSF4 is primarily expressed on activated CD4+ and CD8+ T cells following engagement of the T cell receptor (TCR) by antigen-presenting cells, along with co-stimulation through CD40-CD40 Ligand and CD28-B7 interactions .

The receptor plays several key roles in immune function:

  • Promotes T cell survival and proliferation

  • Enhances cytokine production by activated T cells

  • Inhibits the conversion of effector T cells into regulatory T cells (Tregs)

  • Supports the maintenance of and recall response in memory T cells

  • Enhances sensitivity of Tregs to IL-2, promoting their proliferation while potentially decreasing their immunosuppressive capacity

These functions make TNFRSF4 an important molecule in orchestrating immune responses, particularly in the context of inflammation, autoimmunity, and anti-tumor immunity .

How does recombinant rat TNFRSF4 differ structurally from human and mouse variants?

Rat TNFRSF4 shares significant homology with human and mouse variants but maintains species-specific differences that researchers should consider when designing experiments. The extracellular domain (ECD) of human OX40 shares approximately 63% sequence identity with the ECD of both mouse and rat OX40 .

Human OX40 is a 48 kDa type I transmembrane glycoprotein with:

  • A 28 amino acid signal sequence

  • A 185 amino acid extracellular domain containing a cysteine-rich region

  • A 20 amino acid transmembrane segment

  • A 41 amino acid cytoplasmic domain

While the core structure is preserved across species, these differences in sequence homology can affect:

  • Binding affinity to ligands

  • Recognition by species-specific antibodies

  • Potential cross-reactivity in experimental systems

  • Differential responses to therapeutic interventions

Researchers should carefully consider these structural differences when translating findings between species or when designing experiments using recombinant proteins from different species .

What are the optimal conditions for using recombinant rat TNFRSF4 in binding assays?

When conducting binding assays with recombinant rat TNFRSF4, optimizing several parameters is crucial for obtaining reliable results:

Coating Concentration:
Based on data from human TNFRSF4 studies, a coating concentration of 0.25 μg/mL has been found effective for binding assays. For rat TNFRSF4, a similar range (0.2-0.5 μg/mL) is recommended as a starting point for optimization .

Buffer Conditions:

  • Coating buffer: Phosphate-buffered saline (PBS, pH 7.2-7.4)

  • Blocking solution: PBS with 1-5% BSA or 1-5% non-fat dry milk

  • Washing buffer: PBS with 0.05% Tween-20

Incubation Parameters:

  • Coating incubation: 16-18 hours at 4°C

  • Blocking: 1-2 hours at room temperature

  • Sample incubation: 2 hours at room temperature or overnight at 4°C

  • Detection antibody incubation: 1-2 hours at room temperature

Detection Methods:

  • For direct binding assays: Labeled ligands (TNFSF4/OX40L) or anti-TNFRSF4 antibodies

  • For sandwich assays: Capture antibody, sample containing TNFRSF4, and detection antibody

Optimization Recommendations:

  • Perform serial dilutions of coating protein to determine optimal concentration

  • Test multiple blocking agents to minimize background

  • Include proper negative controls (irrelevant proteins) and positive controls

  • Validate results using multiple detection methods

When determining binding kinetics, it's important to note that human recombinant OX40/TNFRSF4 binds to OX40 Ligand/TNFSF4 with an ED50 of 0.25-1.5 ng/mL under optimal conditions . Similar binding parameters might be expected for the rat protein, though species-specific validation is essential.

How can recombinant rat TNFRSF4 be used in T cell activation studies?

Recombinant rat TNFRSF4 can be utilized in various ways to study T cell activation, differentiation, and function:

Plate-bound Stimulation:

  • Coat plates with anti-CD3 antibody (1-5 μg/mL) along with recombinant TNFRSF4 ligand (TNFSF4/OX40L, 1-10 μg/mL)

  • Isolate rat T cells using magnetic separation or flow cytometry

  • Culture T cells in coated wells for 24-72 hours

  • Assess activation markers (CD25, CD69), proliferation, and cytokine production

Soluble Co-stimulation:

  • Activate T cells with anti-CD3/CD28 beads or PMA/ionomycin

  • Add soluble recombinant TNFSF4/OX40L (1-5 μg/mL) to culture medium

  • Incubate for desired timepoints (typically 24-96 hours)

  • Measure proliferation, survival, and cytokine production

Receptor Blocking Studies:

  • Pre-incubate T cells with recombinant TNFRSF4 (5-20 μg/mL) to compete with cell-surface TNFRSF4

  • Expose cells to TNFSF4/OX40L-expressing cells or recombinant ligand

  • Assess the impact on T cell activation and function

Flow Cytometry Applications:

  • Stimulate T cells under various conditions

  • Use fluorescently-labeled anti-TNFRSF4 antibodies to track receptor expression

  • Correlate TNFRSF4 expression with other activation markers and functional readouts

Assessment Parameters:

  • Proliferation: CFSE dilution, 3H-thymidine incorporation, or Ki-67 staining

  • Cytokine production: ELISA or intracellular cytokine staining for IL-2, IFN-γ, TNF-α

  • Survival: Annexin V/PI staining

  • Long-term memory: Phenotypic markers (CD44, CD62L) and recall responses

These approaches can be particularly valuable when studying the role of TNFRSF4 in T cell responses to tumors, as TNFRSF4 pathways are promising targets for cancer immunotherapy .

What are the optimal storage and handling conditions for recombinant rat TNFRSF4?

Proper storage and handling of recombinant rat TNFRSF4 is crucial to maintain its biological activity and structural integrity:

Recommended Storage Conditions:

  • Lyophilized protein: -20°C to -80°C for long-term storage

  • Reconstituted protein:

    • Working aliquots: -20°C for up to 3 months

    • Long-term storage: -80°C in single-use aliquots

    • Avoid repeated freeze-thaw cycles (limit to ≤5 cycles)

Reconstitution Guidelines:

  • Use sterile, molecular biology-grade water or appropriate buffer

  • For most applications, reconstitute to a concentration of 0.1-1.0 mg/mL

  • Allow protein to sit at room temperature for 5-10 minutes after adding solvent

  • Gently mix by inversion or mild vortexing; avoid vigorous shaking

  • Centrifuge briefly to collect material at the bottom of the tube

Working Solution Preparation:

  • Dilute stock solutions in appropriate assay buffer immediately before use

  • Use polypropylene tubes to minimize protein adhesion to tube walls

  • For cell culture applications, ensure sterility of final solution

  • Consider adding carrier protein (0.1-0.5% BSA) for very dilute working solutions

Stability Indicators:

  • Monitor protein performance in functional assays over time

  • Examine SDS-PAGE profile periodically to assess degradation

  • Under recommended storage conditions, stability should be maintained for at least 6 months

Shipping and Handling:

  • Transport on dry ice for frozen samples

  • Minimize exposure to room temperature

  • Upon receipt, immediately transfer to appropriate storage conditions

  • Document date of receipt and reconstitution

Following these guidelines will help ensure consistent experimental results and maximize the usable lifetime of recombinant rat TNFRSF4 preparations .

What methods are most effective for validating the biological activity of recombinant rat TNFRSF4?

Validating the biological activity of recombinant rat TNFRSF4 requires a multi-faceted approach to ensure the protein maintains its structural integrity and functional capacity:

1. Binding Assays:

  • ELISA-based binding to anti-TNFRSF4 antibodies

  • Surface Plasmon Resonance (SPR) to measure interaction with TNFSF4/OX40L

  • Flow cytometry to assess binding to TNFSF4-expressing cells

2. Functional Cell-Based Assays:

  • T cell proliferation assays using rat T cells

  • Cytokine production (IL-2, IFN-γ) following TNFRSF4 engagement

  • NF-κB reporter assays in appropriate cell lines

3. Structural Validation:

  • SDS-PAGE analysis under reducing and non-reducing conditions

    • Expected molecular weight: 40-44 kDa (based on human TNFRSF4 data)

  • Western blotting with specific anti-TNFRSF4 antibodies

  • Mass spectrometry to confirm protein identity and purity

4. Activity Comparison Protocol:
When validating a new lot of recombinant rat TNFRSF4:

Test ParameterMethodAcceptance Criteria
PuritySDS-PAGE≥95% pure; single band at 40-44 kDa
IdentityWestern BlotSingle specific band at expected MW
Binding ActivityELISA or SPR≤20% deviation from reference standard
Functional ActivityT cell assay≤30% deviation from reference standard
EndotoxinLAL assay≤1.0 EU/μg protein

5. Establishing a Reference Standard:

  • Create an internal reference standard from a well-characterized lot

  • Test each new lot against this standard

  • Document acceptance criteria for each validation parameter

6. Troubleshooting Poor Activity:

  • Check for protein aggregation by dynamic light scattering

  • Verify correct folding using circular dichroism

  • Ensure absence of proteolytic degradation

  • Test different buffer formulations to improve stability

Regular validation using these methods ensures that experimental results remain consistent and reliable across different batches of recombinant TNFRSF4 .

How can recombinant rat TNFRSF4 be used to study regulatory T cell function?

Recombinant rat TNFRSF4 provides valuable tools for investigating the complex relationship between this receptor and regulatory T cell (Treg) biology:

Experimental Approaches:

1. Treg Stability and Plasticity:

  • Culture isolated rat Tregs (CD4+CD25+Foxp3+) with recombinant TNFSF4/OX40L (1-10 μg/mL)

  • Monitor Foxp3 expression over 3-7 days by flow cytometry and RT-PCR

  • Assess production of cytokines (IL-10, TGF-β, IFN-γ, IL-17)

  • Evaluate epigenetic changes at the Foxp3 locus using bisulfite sequencing

2. Functional Suppression Assays:

  • Pre-treat Tregs with TNFSF4/OX40L for 24-48 hours

  • Co-culture with CFSE-labeled conventional T cells (Tconv) at ratios of 1:1 to 1:8 (Treg:Tconv)

  • Stimulate with anti-CD3/CD28 and measure Tconv proliferation after 3-5 days

  • Calculate suppressive capacity relative to untreated Tregs

3. IL-2 Responsiveness:

  • Treat Tregs with recombinant TNFSF4/OX40L for 6-24 hours

  • Measure expression of IL-2 receptor components (CD25, CD122, CD132) by flow cytometry

  • Assess STAT5 phosphorylation following IL-2 stimulation

  • Determine proliferative response to low-dose IL-2 (1-10 IU/mL)

4. Competitive Receptor Binding:

  • Use soluble recombinant TNFRSF4 to block OX40-OX40L interactions

  • Examine effects on Treg homeostasis in co-culture systems

  • Analyze impact on Treg-mediated suppression of effector T cells

Experimental Considerations:

  • Always include appropriate controls (unstimulated Tregs, Tregs treated with irrelevant recombinant proteins)

  • Validate findings using both recombinant proteins and agonistic antibodies

  • Consider the impact of the experimental microenvironment (cytokines, cell density)

  • Account for potential differences between in vitro observations and in vivo behavior

These methodologies can help elucidate the complex role of TNFRSF4 in Treg biology, which has significant implications for understanding autoimmunity, tumor immunity, and inflammatory diseases .

What are the methodologies for using recombinant rat TNFRSF4 in cancer immunotherapy research models?

Recombinant rat TNFRSF4 can be employed in various experimental paradigms to investigate cancer immunotherapy approaches targeting the OX40/TNFRSF4 pathway:

1. In Vitro Tumor-Specific T Cell Activation:

Protocol:

  • Isolate T cells from rats immunized with tumor antigens

  • Culture T cells with autologous dendritic cells pulsed with tumor lysate

  • Add recombinant TNFSF4/OX40L (2-5 μg/mL) or agonistic anti-TNFRSF4 antibodies

  • Measure:

    • T cell proliferation and survival (flow cytometry)

    • Cytokine production (ELISA/multiplex assays)

    • Cytotoxicity against tumor cells (51Cr release or flow-based assays)

2. Ex Vivo Expansion of Tumor-Infiltrating Lymphocytes (TILs):

Protocol:

  • Isolate TILs from rat tumor models

  • Expand cells using anti-CD3/CD28 stimulation supplemented with IL-2

  • Add recombinant TNFSF4/OX40L during expansion phase

  • Assess:

    • Expansion efficiency (cell counting, viability)

    • Phenotypic characteristics (effector/memory markers)

    • Tumor-specific reactivity before adoptive transfer

3. Combination Therapy Studies:

Preclinical evidence suggests enhanced efficacy when combining TNFRSF4 agonists with other immunotherapeutic approaches . Design experiments to test:

Combination StrategyMethodologyReadouts
TNFRSF4 + CTLA-4 blockadeAdd recombinant TNFSF4/OX40L with anti-CTLA-4 antibodies to T cell culturesProliferation, activation markers, cytokine profile
TNFRSF4 + PD-1 blockadeCombine TNFSF4/OX40L with anti-PD-1 in exhausted T cell assaysRestoration of function, exhaustion marker expression
TNFRSF4 + cancer vaccinesAdminister TNFSF4/OX40L with tumor antigen vaccines in vivoTumor growth, survival, T cell infiltration

4. Soluble TNFRSF4 as a Competitive Inhibitor:

Protocol:

  • Pre-treat tumor-bearing rats with soluble recombinant TNFRSF4

  • Assess impact on:

    • Tumor growth and metastasis

    • Tumor-infiltrating immune cell populations

    • Systemic immune parameters

5. Mechanistic Studies:

Protocol to Assess Memory Formation:

  • Activate rat T cells in vitro with tumor antigens plus TNFSF4/OX40L

  • Transfer cells to tumor-bearing recipients

  • After tumor clearance, rechallenge with tumor cells

  • Analyze:

    • Protection from rechallenge

    • Persistence of tumor-specific T cells

    • Memory phenotype markers (CD44hi, CD62L+/-)

These approaches leverage findings that targeting TNFRSF4 with agonistic antibodies promotes tumor control in preclinical models and enhances CTL effector capabilities . The combination of TNFRSF4 stimulation with other immunotherapies like CTLA-4 blockade has shown particular promise, significantly improving tumor eradication and survival in multiple preclinical models .

How should researchers interpret conflicting results between in vitro and in vivo TNFRSF4 studies?

When confronted with discrepancies between in vitro and in vivo findings related to recombinant rat TNFRSF4, consider the following methodological approaches to reconciliation:

Systematic Analysis Framework:

1. Evaluate Model Differences:

  • Protein concentration disparities: In vitro concentrations of recombinant TNFRSF4 or its ligand typically exceed physiological levels

  • Temporal dynamics: In vitro studies often capture a single timepoint versus the dynamic changes in vivo

  • Microenvironmental factors: Absence of complex cytokine milieu and cellular interactions in vitro

2. Methodological Reconciliation Approaches:

  • Dose-response studies: Test multiple concentrations of recombinant proteins to identify potential threshold effects

  • Time-course experiments: Capture temporal changes in TNFRSF4 signaling over extended periods

  • Ex vivo validation: Isolate cells from in vivo experiments for immediate functional testing

  • In vitro simulation of in vivo conditions: Add relevant cytokine cocktails to better mimic the in vivo environment

3. Technical Validation Protocol:

  • Confirm protein activity using multiple independent assays

  • Verify antibody specificity with appropriate controls

  • Assess endogenous TNFRSF4 expression levels across experimental systems

  • Determine protein half-life in different experimental conditions

Troubleshooting Guide for Common Discrepancies:

ObservationPossible ExplanationValidation Approach
Strong in vitro effect, weak in vivo responseInsufficient bioavailability in vivoPharmacokinetic studies; test multiple dosing regimens
Opposite effects in different modelsCell type-specific responsesFlow cytometry to identify responding populations; cell isolation and testing
Temporal differences in responseDynamic regulation of receptor expressionTime-course studies with receptor quantification
Variation between recombinant protein and genetic approachesDevelopmental compensation in genetic modelsUse inducible systems; acute interventions

Case Study Approach:
When examining TNFRSF4's role in regulatory T cells, research has shown seemingly contradictory effects—enhancing Treg proliferation while potentially diminishing suppressive function . Reconciling such findings requires:

  • Distinguishing between direct receptor effects and secondary consequences

  • Considering the activation state of the target cells

  • Accounting for the specific experimental context (inflammatory vs. homeostatic)

  • Examining the kinetics of receptor engagement

By systematically addressing these factors, researchers can develop a more nuanced understanding of TNFRSF4 biology that accommodates apparent contradictions between experimental systems .

What are the key considerations when validating anti-TNFRSF4 antibodies for research applications?

Thorough validation of anti-TNFRSF4 antibodies is essential for ensuring experimental reliability and reproducibility. Researchers should implement these comprehensive validation strategies:

1. Specificity Validation:

Western Blot Analysis:

  • Test antibody against recombinant rat TNFRSF4 protein

  • Examine lysates from TNFRSF4-expressing and non-expressing cells

  • Verify single band at expected molecular weight (approximately 40-44 kDa)

  • Include positive controls (activated T cells) and negative controls (resting T cells or TNFRSF4-negative cell lines)

Flow Cytometry Validation:

  • Compare staining patterns on known TNFRSF4+ and TNFRSF4- populations

  • Perform blocking studies with recombinant TNFRSF4

  • Test on cells from TNFRSF4 knockout animals (if available)

  • Confirm upregulation following T cell activation

2. Functional Validation:

Neutralization Assays:

  • Assess ability to block TNFRSF4-TNFSF4 interactions

  • Measure impact on downstream signaling events (NF-κB activation)

  • Quantify effects on T cell proliferation and cytokine production

  • Compare to established reference antibodies when available

3. Cross-Reactivity Assessment:

TargetMethodologyAcceptance Criteria
Other TNFR family membersELISA, Western blot<5% cross-reactivity
Human/mouse TNFRSF4Species-specific cell linesDocumented cross-reactivity profile
Fc receptorsPre-block with isotype controlElimination of non-specific binding

4. Application-Specific Validation:

Immunohistochemistry:

  • Test multiple fixation protocols (paraformaldehyde, acetone, methanol)

  • Compare staining patterns with published TNFRSF4 expression data

  • Perform antigen retrieval optimization

  • Include peptide competition controls

ELISA Development:

  • Determine optimal antibody pair (capture/detection)

  • Establish standard curve with recombinant protein

  • Define detection limits and linear range

  • Validate in biological samples with varying TNFRSF4 levels

5. Batch-to-Batch Consistency:

  • Document lot numbers and maintain reference standards

  • Test each new antibody lot against previous lots

  • Establish acceptance criteria for key parameters

  • Store validation data in accessible laboratory records

6. Experimental Controls for Routine Use:

  • Include isotype control antibodies

  • Implement fluorescence-minus-one (FMO) controls for flow cytometry

  • Use stimulated and unstimulated T cells as biological controls

  • Include recombinant TNFRSF4 protein as technical standard

By implementing these rigorous validation protocols, researchers can confidently use anti-TNFRSF4 antibodies for various applications while minimizing the risk of artifactual or misleading results .

What are promising approaches for studying TNFRSF4 interactions with other co-stimulatory and co-inhibitory pathways?

Investigating the complex interplay between TNFRSF4 and other immune regulatory pathways requires sophisticated experimental approaches. Here are methodologies for elucidating these important interactions:

1. Multi-Parameter Analysis Techniques:

Combinatorial Co-stimulation Assays:

  • Stimulate T cells with defined combinations of receptor agonists/antagonists:

    • TNFRSF4/OX40 + CD28

    • TNFRSF4/OX40 + PD-1

    • TNFRSF4/OX40 + CTLA-4

    • TNFRSF4/OX40 + other TNFR family members (4-1BB, CD27, GITR)

  • Measure synergistic or antagonistic effects on:

    • Proliferation (CFSE dilution)

    • Cytokine production (multiplex assays)

    • Gene expression (NanoString or RNA-seq)

    • Metabolic parameters (Seahorse analysis)

2. Signaling Pathway Crosstalk:

Biochemical Interaction Studies:

  • Immunoprecipitation of TNFRSF4 followed by mass spectrometry

  • Proximity ligation assays to detect molecular interactions in situ

  • FRET/BRET approaches to measure dynamic receptor interactions

  • Phosphoproteomic analysis following combined receptor engagement

Suggested Protocol:

  • Stimulate rat T cells with anti-CD3 + combinations of co-stimulatory ligands

  • At defined timepoints (5min, 15min, 30min, 2h), lyse cells and perform phosphoprotein analysis

  • Focus on key nodes: NF-κB, MAPK, PI3K/Akt, and JAK/STAT pathways

  • Create signaling network maps comparing single vs. combined stimulation

3. Genetic Manipulation Approaches:

Sequential and Simultaneous Receptor Blockade:

  • Use CRISPR/Cas9 to generate single and double receptor knockout T cells

  • Employ inducible systems to control timing of receptor expression

  • Apply siRNA knockdown for transient targeting

  • Implement domain-specific mutations to identify critical interaction regions

4. Analysis Framework for Combination Studies:

CombinationMethodologyKey ReadoutsInterpretation Guidance
TNFRSF4 + CTLA-4 blockadeStimulate T cells with TNFSF4/OX40L ± anti-CTLA-4Proliferation, IL-2, IFN-γAssess synergy using Bliss independence model
TNFRSF4 + 4-1BB stimulationAdminister both TNFR agonists at varying ratiosCytolytic activity, survivalCompare to predicted additive effects
TNFRSF4 + PD-1 blockadeCombined treatment of exhausted T cellsExhaustion marker reversalMonitor temporal dynamics of recovery

5. Translational Research Considerations:

Research has already shown promising results from combining TNFRSF4 agonists with other immunotherapeutic approaches. For example, combining CTLA-4 blockade with TNFRSF4 co-stimulation significantly improved tumor eradication and survival in multiple preclinical models . These preclinical findings provide a strong rationale for clinical evaluation of these combination approaches.

When designing such studies, researchers should:

  • Establish clear definitions of synergy versus additivity

  • Include comprehensive dose-response analyses

  • Consider temporal aspects of receptor engagement

  • Account for potential homeostatic feedback mechanisms

These methodologies provide a framework for systematically dissecting the complex interactions between TNFRSF4 and other immune regulatory pathways, advancing our understanding of immune regulation and informing the development of more effective immunotherapeutic strategies .

What methodological approaches can address the challenges in translating TNFRSF4 research from rat models to human applications?

Translating findings from rat TNFRSF4 studies to human applications presents several challenges that require rigorous methodological approaches:

1. Species-Specific Differences Assessment:

Comparative Sequence and Structure Analysis:

  • Perform detailed alignment of rat and human TNFRSF4 sequences

  • Identify conserved versus divergent domains

  • Model structural differences using X-ray crystallography or cryo-EM

  • Map species-specific differences to functional domains

Functional Comparison Protocol:

  • Express both rat and human TNFRSF4 in the same cellular background

  • Stimulate with species-matched or cross-species ligands

  • Compare signaling dynamics, gene expression profiles, and functional outcomes

  • Identify conserved versus species-specific response elements

2. Cross-Species Reactivity Testing:

Binding Assays:

  • Test binding of rat TNFSF4/OX40L to human TNFRSF4 and vice versa

  • Determine affinity constants and binding kinetics

  • Perform competition assays with species-specific antibodies

  • Create detailed cross-reactivity matrices for research reagents

Comparison Table Template:

ReagentRat TNFRSF4 ReactivityHuman TNFRSF4 ReactivityMouse TNFRSF4 ReactivityNotes
Antibody clone X+++++-High human cross-reactivity
Recombinant TNFSF4 (rat)++++++Limited human binding
Small molecule X+++++++++Species-independent

3. Humanized Model Systems:

Development Approach:

  • Create rats expressing human TNFRSF4 (knock-in models)

  • Develop human immune system engrafted rat models

  • Establish rat/human chimeric receptor systems

  • Generate reporter cell lines expressing human TNFRSF4 in rat background

4. Translational Validation Framework:

Multi-System Verification:

  • Test findings in rat primary cells, rat cell lines, and rat in vivo models

  • Validate in human primary cells and human cell lines

  • Confirm in human tissues (when available)

  • Develop parallel assays across species for direct comparison

5. Therapeutic Development Considerations:

Antibody Humanization Strategy:

  • Start with rat anti-TNFRSF4 antibodies with known function

  • Identify complementarity-determining regions (CDRs)

  • Graft CDRs onto human antibody framework

  • Test binding and functional properties

  • Optimize affinity and pharmaceutical properties

Cross-Species Binding Assessment:
When developing agonistic antibodies against TNFRSF4 for potential therapeutic use, carefully validate:

  • Epitope conservation between species

  • Fc receptor interactions in different species

  • Antibody-dependent cellular cytotoxicity variations

  • Dose-response relationships across species

6. Ex Vivo Human Sample Testing:

Protocol Example:

  • Obtain human peripheral blood mononuclear cells (with appropriate consent)

  • Isolate T cell subsets of interest

  • Stimulate with anti-CD3/CD28 to upregulate TNFRSF4

  • Test rat-derived hypotheses using human-specific reagents

  • Compare results directly to parallel rat experiments

By systematically addressing species differences while focusing on conserved biology, researchers can develop more effective translational strategies for moving TNFRSF4-targeted approaches from rat models to human applications .

What are the most critical considerations when designing experiments with recombinant rat TNFRSF4?

When designing experiments with recombinant rat TNFRSF4, researchers should prioritize these critical considerations to ensure robust and reproducible results:

1. Reagent Quality and Characterization:

  • Verify protein purity (≥95%) using SDS-PAGE under both reducing and non-reducing conditions

  • Confirm protein identity through mass spectrometry or western blotting

  • Validate biological activity through functional assays before experimental use

  • Document lot-to-lot variation and establish internal reference standards

2. Experimental Design Parameters:

  • Include comprehensive controls:

    • Negative controls (unstimulated cells, irrelevant recombinant proteins)

    • Positive controls (known TNFRSF4 activators)

    • Isotype controls for antibody experiments

    • Vehicle controls for all buffers and solvents

  • Design dose-response studies to identify optimal concentrations

  • Perform time-course experiments to capture dynamic responses

  • Account for potential species-specific differences when extrapolating findings

3. Technical Implementation:

  • Optimize protein storage and handling to maintain activity

  • Standardize experimental protocols to minimize variability

  • Consider the impact of experimental microenvironment (media, serum, cell density)

  • Validate key findings using multiple complementary approaches

4. Data Interpretation Framework:

  • Distinguish between direct and indirect effects of TNFRSF4 manipulation

  • Consider cell type-specific responses (CD4+ vs. CD8+ T cells, Tregs vs. effector T cells)

  • Interpret findings in the context of the complex immune microenvironment

  • Acknowledge limitations when translating between in vitro and in vivo systems

5. Translational Relevance Assessment:

  • Evaluate conservation of findings across species

  • Consider physiological relevance of recombinant protein concentrations

  • Assess consistency between recombinant protein and genetic approaches

  • Determine potential implications for therapeutic applications

By addressing these critical considerations, researchers can design more rigorous experiments that yield reliable insights into TNFRSF4 biology, advancing both fundamental understanding and therapeutic applications targeting this important co-stimulatory pathway .

How should researchers integrate findings from TNFRSF4 studies into broader immune pathway research?

Effective integration of TNFRSF4 research findings into the broader context of immune regulation requires systematic approaches that connect molecular mechanisms to physiological outcomes:

1. Multi-Omics Integration Strategies:

Recommended Protocol:

  • Generate datasets examining TNFRSF4 manipulation using complementary approaches:

    • Transcriptomics (RNA-seq or microarray)

    • Proteomics (mass spectrometry)

    • Epigenomics (ChIP-seq, ATAC-seq)

    • Metabolomics (MS or NMR-based)

  • Apply computational integration methods:

    • Pathway enrichment analysis

    • Network modeling approaches

    • Systems biology frameworks

  • Identify convergent and divergent impacts across datasets

  • Validate key nodes experimentally

2. Contextual Analysis Framework:

Immune Subsystem Mapping:

  • Position TNFRSF4 within T cell co-stimulatory networks

  • Compare effects with other TNFR family members

  • Examine intersection with canonical T cell signaling pathways

  • Assess relationship to other immune cell populations (B cells, dendritic cells, etc.)

Pathway IntersectionKey Shared MoleculesFunction IntegrationExperimental Validation Method
TNFRSF4-NF-κBTRAF2, IKK complexSurvival promotionNF-κB reporter assays with TNFRSF4 stimulation
TNFRSF4-MAPKTRAF2, MAP3KsProliferation, cytokine productionPhosphoflow analysis of ERK/JNK/p38
TNFRSF4-PI3KUnknown adaptorMetabolic regulationMetabolic flux analysis following TNFRSF4 engagement

3. Translational Pathway Integration:

Research-to-Application Pipeline:

  • Identify TNFRSF4-dependent mechanisms in fundamental research

  • Connect to disease-relevant pathways through literature and database mining

  • Develop targeted hypotheses for specific disease contexts

  • Test in appropriate disease models with readouts linked to human pathology

4. Collaborative Research Frameworks:

Cross-Disciplinary Approach:

  • Establish collaborations between TNFR biology experts and specialists in:

    • Other immune receptor families

    • Computational biology and systems immunology

    • Disease-specific research (cancer, autoimmunity, infection)

    • Drug development and therapeutic antibody engineering

  • Develop shared resources and standardized protocols for TNFRSF4 research

  • Create accessible databases of TNFRSF4-related experimental results

5. Research Prioritization Model:

Decision Matrix for Next Steps:

  • Identify knowledge gaps in TNFRSF4 biology

  • Prioritize questions with highest potential impact

  • Consider technical feasibility and available resources

  • Focus on areas with therapeutic potential

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.