Recombinant Rat Tumor protein p53-inducible protein 11 (Tp53i11)

Shipped with Ice Packs
In Stock

Description

Key Features:

PropertyDetail
Molecular Weight~20.9 kDa (predicted)
Post-Translational ModificationsPhosphorylation sites identified (e.g., S15, Y20)
Subcellular LocalizationMembrane-associated
Interacting PartnersATXN1 (ataxin-1), p53, and redox-responsive proteins

Production Systems

Recombinant rat Tp53i11 is produced using:

  • E. coli: For cost-effective yields with N-terminal His/Myc/DDK tags .

  • HEK293 Cells: For post-translationally modified, functional studies .

  • Baculovirus: For high-purity (>80%) protein suitable for structural analyses .

Example Purification Metrics (HEK293-derived):

ParameterValue
Purity>80% (SDS-PAGE)
Storage-80°C in PBS + 10% glycerol
Stability6 months with minimal freeze-thaw cycles

Pathway Involvement

Tp53i11 is implicated in:

  • p53 Signaling: Amplifies p53-dependent apoptosis via ROS modulation .

  • Cell Cycle Arrest: Mediates G1/S checkpoint activation under genotoxic stress .

  • Chemical Response: Modulates sensitivity to arsenic trioxide (As₂O₃) and environmental toxins .

Key Research Findings

Stimulus/InteractionEffect on Tp53i11MechanismSource
2,3,7,8-Tetrachlorodibenzo-p-dioxin (TCDD)Decreases mRNA expressionAryl hydrocarbon receptor activation
Arsenic TrioxideIncreases susceptibility to apoptosisROS-dependent transcriptional activation
Bisphenol AAlters methylation/expressionEpigenetic dysregulation
CamptothecinUpregulates mRNADNA damage response

Applications in Experimental Models

  • Protein-Pro Interaction Studies: Used in pull-down assays to map binding partners like ATXN1 .

  • In Vitro Transcription Assays: Evaluates p53-dependent gene activation .

  • Apoptosis Modulation: Tests chemosensitization effects in cancer cell lines .

Case Study:

In rat hepatocytes, recombinant Tp53i11 overexpression enhanced arsenic trioxide-induced apoptosis by 2.3-fold, linked to ROS accumulation and mitochondrial membrane depolarization .

Challenges and Limitations

  • Stability Issues: Requires stringent storage conditions (-80°C) to prevent aggregation .

  • Antibody Specificity: Commercial antibodies (e.g., ab234860) show cross-reactivity with mouse orthologs .

  • Functional Redundancy: Overlaps with other p53-induced proteins (e.g., PIG3, PIG8), complicating phenotype interpretation .

Future Directions

  • Structural Studies: Resolve 3D conformation to identify druggable pockets .

  • In Vivo Models: Generate Tp53i11-KO rats to delineate tissue-specific roles .

  • Therapeutic Screening: Test Tp53i11-enhancing compounds for adjuvant cancer therapies .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary based on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
Tp53i11; Pig11; Tumor protein p53-inducible protein 11; p53-induced gene 11 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-189
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Tp53i11
Target Protein Sequence
MAAKQPPPLMKKHSQTDLVSRLKTRKILGVGGEDDDGEVHRSKISQVLGNEIKFAVREPL GLRVWQFLSAMLFSSVAIMALALPDQLYDAVFDGAEVTSKTPIRLYGGALLSISLIMWNA LYTAEKVIIRWTLLTEACYFGVQSLVVTATLAETGLMSLGTLLLLASRLLFVIVSIYYYY QVGRKPKKV
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Tp53i11 and what is its relationship with p53?

Tumor protein p53-inducible protein 11 (Tp53i11) was first identified approximately two decades ago as an early transcriptional target of the tumor suppressor protein p53. It is upregulated in response to p53 activation, such as during DNA damage or when cells are exposed to chemotherapeutic agents like doxorubicin (DOX) . Several studies have focused on Tp53i11 as a tumor suppressor that can induce apoptosis in cancer cells, though the underlying mechanisms remain partially ambiguous . As a p53 target gene, Tp53i11 plays a significant role in mediating the tumor-suppressive functions of p53, particularly in regulating calcium homeostasis and metabolic processes in cells.

What experimental methods are recommended for studying Tp53i11 expression?

For comprehensive analysis of Tp53i11 expression, multiple complementary techniques should be employed:

  • RT-qPCR: This method provides quantitative assessment of Tp53i11 mRNA levels and is particularly useful for measuring expression changes in response to treatments. Studies have effectively used this approach to demonstrate Tp53i11 upregulation following doxorubicin treatment in various cell lines .

  • RNA Sequencing: For unbiased transcriptome-wide analysis, RNA-seq offers comprehensive insights into Tp53i11 expression changes in the context of global gene expression patterns. This approach has been successfully applied to identify microRNA-mediated regulation of Tp53i11 .

  • CRISPR-based genomic screening: This powerful technique has been effectively used to identify regulatory factors affecting Tp53i11 expression, particularly in identifying microRNAs that target Tp53i11 .

  • Calcium imaging: Given Tp53i11's role in calcium homeostasis, functional assessment using calcium indicators like TuNer-s ratio provides crucial information about how Tp53i11 manipulation affects endoplasmic reticulum calcium levels .

  • Patient-derived transcriptome data: Analysis of publicly available datasets (such as GSE137356 and GSE222984) allows for clinical correlation of Tp53i11 expression with disease states and treatment responses .

How does Tp53i11 influence cellular calcium homeostasis?

Tp53i11 plays a critical role in regulating calcium homeostasis, particularly in the endoplasmic reticulum (ER):

  • Direct regulation of ER calcium levels: Experimental evidence using calcium imaging demonstrates that Tp53i11 knockdown significantly reduces the TuNer-s ratio in HeLa and HEK293 cells, indicating decreased ER calcium levels. Conversely, overexpression of Tp53i11 increases the TuNer-s ratio, reflecting elevated basal ER calcium levels .

  • Downstream mediator of microRNA effects: Multiple microRNAs that lower ER calcium levels do so by downregulating Tp53i11, positioning it as a central regulator in miRNA-mediated calcium homeostasis .

  • Functional consequences: Changes in ER calcium levels mediated by Tp53i11 directly affect cancer cell proliferation, with elevated ER calcium associated with reduced proliferation rates .

  • Therapeutic implications: Chemotherapeutic agents like doxorubicin upregulate Tp53i11 and enhance ER calcium accumulation, suggesting that modulation of the Tp53i11-calcium axis may contribute to the anticancer effects of these drugs .

This calcium regulatory function represents a critical mechanism by which Tp53i11 exerts its tumor-suppressive effects in various cancer types.

What is the dual role of Tp53i11 in cell proliferation and survival?

Tp53i11 exhibits a context-dependent dual role in regulating cell proliferation and survival:

This dual functionality suggests that Tp53i11's role in cancer progression is complex and depends on the specific environmental conditions faced by cancer cells during different stages of tumorigenesis and metastasis.

What signaling pathways are associated with Tp53i11?

Tp53i11 interacts with multiple signaling pathways that regulate cell fate and metabolism:

  • p53 pathway: As a direct transcriptional target of p53, Tp53i11 functions within the broader p53 tumor suppressor network. Chemotherapeutic agents like doxorubicin activate p53, leading to increased Tp53i11 expression .

  • AMPK signaling: Tp53i11 negatively regulates AMPK activation, particularly under stress conditions. Loss of Tp53i11 enhances AMPK activation in detached cells and during glucose starvation, conferring metabolic flexibility and stress resistance .

  • Calcium signaling: Tp53i11 increases ER calcium levels, influencing calcium-dependent cellular processes and signaling pathways .

  • EMT-related pathways: Tp53i11 regulates the expression of epithelial markers (E-cadherin, Claudin-1, ZO-1) and mesenchymal markers (N-cadherin, Vimentin, Slug, Snail), suggesting its involvement in signaling pathways controlling epithelial-mesenchymal transition .

  • MicroRNA regulatory networks: Multiple microRNAs target Tp53i11, indicating its position within complex epigenetic regulatory networks that fine-tune its expression in different cellular contexts .

Understanding these signaling interconnections is essential for developing effective strategies to target Tp53i11 for therapeutic purposes.

How does Tp53i11 regulate AMPK activation and metabolic adaptation in cancer cells?

Tp53i11 plays a critical role in regulating AMPK activation and metabolic adaptation in cancer cells, particularly under stress conditions:

  • Inverse relationship with AMPK activation:

    • Loss of Tp53i11 significantly increases AMPK phosphorylation/activation in detached MCF10A and MDA-MB-231 cells .

    • Under glucose starvation, Tp53i11 overexpression reduces AMPK activation, while Tp53i11 knockdown enhances it .

  • Metabolic flexibility conferred by AMPK activation:

    • AMPK activation serves as a metabolic stress response mechanism that preserves energy homeostasis .

    • Enhanced AMPK activation in Tp53i11-deficient cells enables metabolic adaptation to stress conditions like matrix detachment and glucose limitation .

  • Cell cycle effects and quiescence:

    • Under glucose starvation, loss of Tp53i11 decreases the cell population in G2/M phase while increasing cells in G1/G0 phase .

    • This shift toward a more quiescent state likely contributes to enhanced survival under metabolic stress conditions .

  • Functional consequences for cancer progression:

    • The ability to activate AMPK and adapt metabolically is critical for cancer cells encountering nutrient-poor environments during tumor growth and metastasis .

    • By suppressing AMPK activation, Tp53i11 may limit the metabolic flexibility needed for cancer progression under challenging conditions .

This regulatory relationship between Tp53i11 and AMPK highlights a potential vulnerability that could be exploited for therapeutic intervention, particularly in targeting metabolically stressed tumor cells.

What is the role of Tp53i11 in epithelial-mesenchymal transition (EMT) and metastasis?

Tp53i11 functions as a negative regulator of EMT and metastasis through multiple mechanisms:

  • Morphological impact:

    • Tp53i11 knockdown or knockout in MCF10A cells induces spindle-like morphology with increased cell scattering, characteristic of EMT .

    • This morphological change correlates with functional alterations in cell behavior .

  • Molecular marker regulation:

    • In MCF10A cells, loss of Tp53i11 increases mesenchymal markers (N-cadherin, Vimentin, Slug, Snail) and decreases epithelial markers (E-cadherin, Claudin-1, ZO-1) .

    • Conversely, in MDA-MB-231 breast cancer cells, Tp53i11 overexpression reduces mesenchymal markers and enhances epithelial markers .

  • Migration and invasion:

    • Loss of Tp53i11 significantly promotes wound closure, cell migration, and invasion in both MCF10A and MDA-MB-231 cells .

    • Tp53i11 overexpression suppresses these metastasis-associated cellular behaviors .

  • In vivo effects:

    • Tp53i11 overexpression significantly reduces tumor growth in mammary fat pads when MDA-MB-231 cells are injected orthotopically into nude mice .

    • Similar inhibitory effects are observed in tail-vein injection models assessing metastatic potential .

  • Potential mechanism linking metabolism and EMT:

    • The AMPK regulatory function of Tp53i11 may connect metabolic adaptation with EMT progression, as metabolic stress often accompanies and promotes EMT .

These findings establish Tp53i11 as a multifunctional suppressor of metastasis through its inhibitory effects on EMT, highlighting its potential as a therapeutic target for preventing cancer progression.

How do microRNAs regulate Tp53i11 expression and function?

MicroRNAs play a crucial role in regulating Tp53i11 expression and function through complex regulatory networks:

  • Identification of regulatory miRNAs:

    • CRISPR-based genomic screening identified 33 candidate miRNAs that may regulate ER calcium levels, with 10 miRNAs confirmed to significantly lower basal ER calcium levels .

    • RNA sequencing analysis revealed that these miRNAs exert their effects on calcium homeostasis by downregulating Tp53i11 .

    • Additional miRNAs, including hsa-miR-210-3p, hsa-miR-210-5p, and hsa-miR-645, have been identified as targeting Tp53i11 in other contexts .

  • Functional consequences of miRNA regulation:

    • miRNA-mediated downregulation of Tp53i11 leads to reduced ER calcium levels and potentially affects cancer cell proliferation and survival .

    • This regulatory axis represents a novel epigenetic mechanism controlling calcium homeostasis .

  • Complexity and context-dependency:

    • Some miRNAs targeting Tp53i11 have dual roles in cancer progression:

      • hsa-miR-1268b and hsa-miR-4472 are downregulated in breast cancer .

      • hsa-miR-4516 deletion promotes cell proliferation .

      • hsa-miR-622 inhibits cell proliferation, migration, and invasion .

    • These contrasting effects likely stem from tissue-specific expression patterns and the diversity of target genes regulated by each miRNA .

  • Therapeutic implications:

    • Understanding the miRNA-Tp53i11-calcium axis offers potential for novel therapeutic approaches targeting ER calcium modulation .

    • Inhibition of specific miRNAs could potentially upregulate Tp53i11 and enhance its tumor-suppressive functions .

This complex network of miRNA regulation highlights the sophisticated epigenetic control of Tp53i11 expression and its downstream effects on cellular homeostasis and cancer progression.

What experimental models are most appropriate for studying Tp53i11's role in cancer?

Based on published research, multiple complementary experimental models provide valuable insights into Tp53i11's role in cancer:

  • 2D cell culture systems:

    • Cell lines with Tp53i11 knockdown, knockout, or overexpression (MCF10A, MDA-MB-231, HeLa) enable basic mechanistic studies .

    • These systems are particularly useful for molecular and biochemical analyses of Tp53i11's effects on signaling pathways, cell cycle progression, and proliferation.

  • 3D culture models:

    • Spheroid formation assays assess anchorage-independent growth capacity and correlate with in vivo tumor formation potential .

    • Matrigel culture systems evaluate the capacity for invasive growth and branching morphogenesis .

    • These models better recapitulate the tumor microenvironment than traditional 2D cultures.

  • Stress condition models:

    • ECM-detached culture: Growing cells in suspension or on low-attachment plates to study anoikis resistance and survival capacity during detachment .

    • Glucose starvation: Culturing cells in glucose-limited media to assess metabolic adaptability and stress responses .

    • These models are particularly relevant for studying metastatic capacity and adaptation to hostile microenvironments.

  • In vivo models:

    • Orthotopic mammary fat pad injection in nude mice: Evaluates primary tumor growth and local invasion .

    • Tail vein injection: Assesses metastatic colonization capacity .

    • These models provide the most physiologically relevant context for studying tumor progression and metastasis.

  • Clinical sample analysis:

    • Transcriptome analysis of patient samples before and after chemotherapy provides valuable insights into Tp53i11 regulation in clinical settings .

    • Correlation of Tp53i11 expression with clinical outcomes helps validate findings from model systems .

A comprehensive approach utilizing multiple model systems is recommended for a complete understanding of Tp53i11's multifaceted roles in cancer.

What is the relationship between Tp53i11, doxorubicin treatment, and cancer cell response?

Doxorubicin (DOX) treatment interacts with Tp53i11 through multiple mechanisms that impact cancer cell response:

  • Transcriptional upregulation:

    • DOX significantly increases Tp53i11 mRNA expression in multiple cancer cell lines, including HeLa and MDA-MB-231 .

    • This upregulation occurs through DOX's action as a p53 agonist, activating p53-dependent transcription of Tp53i11 .

    • RT-qPCR analysis demonstrates a significant increase in Tp53i11 mRNA levels in HeLa cells after 48 hours of treatment with 25 nM DOX .

  • ER calcium elevation:

    • DOX treatment at 25 nM significantly increases the TuNer-s ratio, indicating elevated basal ER calcium levels .

    • This calcium elevation is mechanistically linked to DOX-induced upregulation of Tp53i11 .

  • Inhibition of cell proliferation:

    • DOX treatment markedly increases cell doubling time in both HeLa and triple-negative breast cancer MDA-MB-231 cells .

    • This anti-proliferative effect correlates with DOX-induced Tp53i11 upregulation and increased ER calcium levels .

  • Clinical relevance:

    • Transcriptome sequencing data from triple-negative breast cancer patients treated with DOX and cyclophosphamide show significant upregulation of Tp53i11 expression compared to untreated controls .

    • This effect is observed regardless of whether DOX is administered in combination or sequentially with cyclophosphamide .

  • Potential therapeutic mechanism:

    • The findings suggest that Tp53i11 upregulation and subsequent ER calcium elevation may be an important mechanism through which DOX exerts its anticancer effects .

    • This pathway represents a potential target for enhancing chemotherapy efficacy or developing novel therapeutic approaches .

Understanding this relationship provides insights into both DOX's mechanism of action and potential strategies for targeting the Tp53i11-calcium axis in cancer therapy.

How can recombinant Tp53i11 be effectively produced and validated for research applications?

Production of functional recombinant Tp53i11 for research purposes requires careful consideration of expression systems, purification methods, and validation approaches:

  • Expression system selection:

    • Mammalian expression systems (HEK293, CHO cells) are likely optimal for producing recombinant rat Tp53i11 with proper folding and post-translational modifications.

    • For studies focusing on basic structural analysis, bacterial systems may be suitable if protein solubility can be maintained.

    • Baculovirus-insect cell systems offer a middle ground between yield and proper protein processing.

  • Purification strategy:

    • Affinity tags (His-tag, GST, FLAG) facilitate efficient purification while minimizing impact on protein function.

    • Size exclusion chromatography and ion exchange chromatography can be employed as secondary purification steps to enhance protein purity.

    • Buffer optimization is critical to maintain protein stability and prevent aggregation.

  • Functional validation:

    • Calcium regulation: The purified protein should be tested for its ability to modulate ER calcium levels using calcium imaging with TuNer-s ratio indicators in reconstituted systems or cell-based assays .

    • Cell proliferation: Recombinant Tp53i11 should demonstrate the capacity to inhibit cancer cell proliferation when introduced into appropriate cell models .

    • AMPK regulation: Functional Tp53i11 should show the ability to modulate AMPK activation under stress conditions .

  • Structural characterization:

    • Circular dichroism spectroscopy to assess secondary structure elements.

    • Mass spectrometry to confirm protein identity and any post-translational modifications.

    • Limited proteolysis to evaluate protein folding and domain organization.

  • Species-specific considerations:

    • When producing rat Tp53i11 specifically, sequence alignment with human and mouse orthologs can identify conserved regions critical for function.

    • Species-specific antibodies should be employed for detection and validation of the recombinant protein.

This methodological approach ensures the production of high-quality recombinant Tp53i11 suitable for diverse research applications in cancer biology and calcium signaling studies.

What therapeutic strategies could target the Tp53i11 pathway in cancer treatment?

Based on current understanding of Tp53i11 function, several promising therapeutic strategies emerge:

  • ER calcium modulation approach:

    • Since Tp53i11 elevates ER calcium levels and inhibits cancer cell proliferation, compounds that enhance ER calcium accumulation through Tp53i11 upregulation represent potential therapeutic agents .

    • Doxorubicin already demonstrates this effect and could serve as a template for developing compounds with more specific activity and reduced toxicity .

  • p53 pathway activation:

    • As Tp53i11 is a p53 target gene, p53 activators or MDM2 inhibitors (like Nutlin-3) could upregulate Tp53i11 expression in cancers with wild-type p53 .

    • This approach would be particularly relevant in cancer types where Tp53i11 exhibits clear tumor-suppressive functions.

  • MicroRNA-based therapies:

    • Inhibition of miRNAs that target Tp53i11 (using antagomirs or locked nucleic acids) could increase Tp53i11 expression .

    • Alternatively, miRNA mimics for tumor-suppressive miRNAs that regulate Tp53i11 might be beneficial in specific contexts .

  • AMPK modulation strategies:

    • Compounds that inhibit AMPK might synergize with Tp53i11 upregulation in preventing metabolic adaptation in cancer cells .

    • This approach could be particularly effective in targeting metastatic cells that rely on metabolic flexibility for survival.

  • EMT inhibition:

    • Given Tp53i11's role in suppressing EMT, combining Tp53i11-targeting approaches with other EMT inhibitors could enhance anti-metastatic effects .

    • This combination might prevent the acquisition of invasive phenotypes during cancer progression.

  • Context-specific targeting:

    • Therapeutic approaches should be tailored to specific cancer types, as Tp53i11 exhibits variable effects depending on tissue context .

    • Molecular profiling of tumors could identify patients most likely to benefit from Tp53i11-targeted therapies.

These strategies represent promising directions for translating the growing understanding of Tp53i11 biology into effective cancer treatments, particularly for metastatic disease that remains challenging to address with current approaches.

How does the tumor microenvironment influence Tp53i11 function in cancer progression?

The tumor microenvironment significantly modulates Tp53i11 function through multiple mechanisms that impact cancer progression:

  • Metabolic stress adaptation:

    • Nutrient limitation (particularly glucose) in the tumor microenvironment activates stress response pathways that interact with Tp53i11 function .

    • Under glucose starvation conditions, Tp53i11 suppresses cell survival, while its loss enhances survival through AMPK activation .

    • This suggests that hypoglycemic regions within tumors might selectively pressure for reduced Tp53i11 expression or function.

  • ECM detachment effects:

    • During metastasis, cancer cells must survive detachment from the extracellular matrix, a condition that normally triggers anoikis .

    • Tp53i11 enhances anoikis in detached cells, while its loss promotes survival and spheroid formation in suspension culture .

    • This indicates that circulating tumor cells might benefit from downregulation of Tp53i11.

  • Hypoxia and p53 modulation:

    • Hypoxic conditions common in solid tumors can stabilize p53, potentially affecting Tp53i11 expression .

    • Hypoxia also induces expression of microRNAs like miR-210, which has been shown to target Tp53i11 .

    • This creates a complex regulatory network where microenvironmental oxygen levels indirectly modulate Tp53i11 function.

  • Calcium signaling context:

    • The tumor microenvironment can affect cellular and ER calcium levels through various mechanisms .

    • Since Tp53i11 regulates ER calcium homeostasis, microenvironmental factors that perturb calcium signaling may interact with Tp53i11 function .

  • ECM composition and EMT induction:

    • The composition of the extracellular matrix can promote EMT in cancer cells .

    • Since Tp53i11 suppresses EMT, microenvironmental factors that induce EMT might counteract or overcome Tp53i11's tumor-suppressive effects .

Understanding these complex interactions between Tp53i11 and the tumor microenvironment is crucial for developing effective therapeutic strategies that account for the heterogeneous and dynamic nature of the cancer ecosystem.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.