Recombinant Rat Type-1 angiotensin II receptor-associated protein (Agtrap)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Agtrap; Atrap; Type-1 angiotensin II receptor-associated protein; AT1 receptor-associated protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Agtrap
Target Protein Sequence
MELPAVNLKVILLVHWLLTTWGCLAFSGSYAWGNFTILALGVWAVAQRDSVDAIGMFLGG LVATIFLDIIYISIFYSSVAVGDTGRFSAGMAIFSLLLKPFSCCLVYHMHRERGGELPLR SDFFGPSQEHSAYQTIDSSDSPADPLASLENKGQAAPRGY
Uniprot No.

Target Background

Function
Recombinant Rat Type-1 angiotensin II receptor-associated protein (Agtrap) appears to be a negative regulator of type-1 angiotensin II receptor signaling. This regulation involves controlling receptor internalization and desensitization mechanisms, such as receptor phosphorylation. Agtrap may also negatively regulate angiotensin II-induced cardiomyocyte hypertrophy by inhibiting the p38 mitogen-activated protein kinase pathway. Furthermore, it attenuates the growth-promoting effects of the type-1 angiotensin II receptor and inhibits angiotensin II-induced phosphorylation of protein kinase AKT and STAT3.
Gene References Into Functions
  1. A single dose of angiotensin(17), at a concentration equivalent to angiotensin II, induced Agtrap gene expression. PMID: 26018598
  2. Myocardial expression of both angiotensin AGTR1 and AGTR2 receptors increased in overfed rats. Ischemia-reperfusion increased receptor expression in control rats but decreased it in overfed rats. PMID: 23383303
  3. AT(1)-AB induces Ang II sensitivity. Mechanistic studies suggest an "autoimmune-activating receptor" contributing to Ang II sensitivity, potentially relevant to preeclampsia. PMID: 21576625
  4. The local renin-angiotensin system is activated in diabetic skin; Angiotensin II receptors type 1 and 2 likely mediate pathological changes. PMID: 21484513
  5. Adipocyte-derived angiotensin II is critical in perivascular adipose tissue-mediated vasoconstriction potentiation in mesenteric arteries. PMID: 20156432
  6. Long-term selective Ang II blockade improves insulin resistance in adipose tissue in a metabolic syndrome model. PMID: 19901849
  7. ATRAP's growth inhibitory effects might stem from interference with angiotensin 1 receptor activation in vascular smooth muscle cell growth. PMID: 17441313
  8. ATRAP promotes AT1R internalization and attenuates the angiotensin II-mediated c-fos-transforming growth factor-beta pathway and proliferative response in vascular smooth muscle cells, suggesting a strategy for inhibiting vascular fibrosis and remodeling. PMID: 17875818
  9. Angiotensin II upregulates TLR4 expression. PMID: 19471094
Database Links
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein. Cytoplasmic vesicle membrane; Multi-pass membrane protein.

Q&A

What is Agtrap and what is its primary biological function?

Agtrap (Angiotensin II Receptor-Associated Protein) functions as a specific binding modulator of the angiotensin II type 1 receptor (AT1R). It directly interacts with the carboxyl-terminal domain of AT1R and promotes constitutive internalization of the receptor, thereby inhibiting pathological activation of downstream signaling while preserving physiological signaling activity . This protein plays a protective role against insulin resistance and metabolic dysfunction, particularly in adipose tissue regulation .

What experimental models are available for studying Agtrap function?

Several experimental models have been developed to study Agtrap function:

  • Agtrap knockout models: Homozygous Agtrap-deficient (Agtrap−/−) mice have been generated by substituting a neomycin resistance gene for exons 3, 4, and 5 in the coding region of the Agtrap gene . These mice show normal physiological phenotypes under standard diet conditions but develop metabolic dysfunction when challenged with a high-fat diet.

  • Agtrap overexpression models: Agtrap transgenic mice have been created to study the effects of enhanced Agtrap expression .

  • Tissue transplantation models: Subcutaneous transplantation of fat pads overexpressing Agtrap from transgenic mice to Agtrap−/− recipient mice has been used to assess tissue-specific effects .

How does Agtrap influence metabolic disorders through adipose tissue regulation?

Agtrap plays a critical protective role in metabolic homeostasis through several mechanisms:

  • Anti-inflammatory effects: Agtrap functions as a novel receptor binding modulator that reduces adipose tissue inflammation, a key driver of metabolic disorders .

  • Metabolic protection: Agtrap−/− mice challenged with high-fat diets develop systemic metabolic dysfunction characterized by increased pad fat accumulation, hypertension, dyslipidemia, and insulin resistance .

  • Functional rescue: The transplantation of adipose tissue overexpressing Agtrap into Agtrap−/− mice significantly improves metabolic parameters, confirming that Agtrap expression in adipose tissue is sufficient to ameliorate systemic metabolic dysfunction .

These findings indicate that Agtrap expression in adipose tissue plays a non-redundant role in maintaining metabolic homeostasis under conditions of nutritional stress.

What role does Agtrap play in cancer progression and prognosis?

Recent evidence indicates that Agtrap may function as a significant biomarker in cancer:

  • Prognostic value: High expression of Agtrap correlates significantly with poor prognosis in hepatocellular carcinoma (HCC) patients (hazard ratio (HR) = 2.13, 95% CI = 1.45–3.03, p = 7.8e-5) .

  • Diagnostic potential: ROC analysis of Agtrap expression in HCC yielded an AUC of 0.856, suggesting strong diagnostic value .

  • Clinical correlation: Agtrap expression shows significant correlation with pathological staging in cancer patients .

A pan-cancer analysis has been conducted to evaluate Agtrap's role across multiple cancer types, although specific findings across different cancers vary .

What molecular mechanisms underlie Agtrap's interaction with the AT1R pathway?

Agtrap modulates AT1R signaling through direct physical interaction with the receptor's carboxyl-terminal domain . This interaction promotes constitutive internalization of AT1R, creating a selective modulatory effect where:

  • Pathological activation of AT1R downstream signaling is inhibited

  • Physiological signaling activity is preserved

This selective modulation explains how Agtrap can maintain essential physiological functions of the angiotensin system while preventing its pathological overactivation in conditions such as metabolic disorders.

What methodology is recommended for generating Agtrap knockout models?

Based on published protocols for generating Agtrap−/− mice, the following methodology is recommended:

Table 1: Protocol for Generating Agtrap Knockout Models

StepProcedureTechnical Details
1Vector designCreate a targeting vector where neomycin resistance gene substitutes exons 3-5 of Agtrap
2Homology armsInclude 4.6-kb 5′ and 4.7-kb 3′ homology arms
3Negative selectionInsert phosphoglycerate kinase 1-thymidine kinase gene at 5′ terminus
4ElectroporationLinearize and electroporate vector into embryonic stem cells (RENKA C57BL/6)
5SelectionScreen G418-resistant clones for homologous recombination
6ValidationConfirm targeting by Southern blot analysis
7PhenotypingTest under both standard and high-fat diet conditions

This methodology ensures specific targeting of the Agtrap gene while minimizing off-target effects.

How should researchers design experiments to study the relationship between Agtrap expression and disease outcomes?

When investigating Agtrap's relationship with disease outcomes, researchers should consider this multifaceted experimental approach:

  • Expression analysis databases:

    • Metabolic Gene Rapid Visualizer (MERAV) for gene expression investigation

    • Cancer Cell Line Encyclopedia (CCLE) for integrated genetic information

    • TCGA datasets for clinical correlations

  • Survival analysis tools:

    • Kaplan-Meier plotter for analyzing prognostic value

    • UALCAN for analyzing relationships between expression and clinicopathological parameters

  • Interaction analysis:

    • cBioPortal for mutation analysis and co-expression gene analysis

    • STRING for demonstrating functional protein networks

  • Statistical approaches:

    • ROC analysis for diagnostic potential

    • Chi-square tests for clinicopathological correlations

    • Cox regression analyses for survival associations

  • Experimental validation:

    • Compare phenotypes between wild-type and Agtrap−/− mice

    • Conduct tissue-specific knockout or overexpression experiments

    • Perform tissue transplantation studies to isolate tissue-specific effects

What statistical approaches are most appropriate for analyzing Agtrap expression data?

For robust analysis of Agtrap expression data, researchers should employ these statistical methods:

Table 2: Recommended Statistical Methods for Agtrap Research

Data TypeRecommended MethodsSoftware ToolsStatistical Thresholds
Comparing differences between groupsStudent's unpaired t-test or ANOVA with Newman–Keuls post-test SPSS (v26.0), GraphPad Prism (v7.0) p < 0.05
Longitudinal measurementsTwo-way ANOVA SPSS, GraphPad Prismp < 0.05
Small sample analysisKruskal–Wallis test with Dunn post-hoc test SPSS, GraphPad Prismp < 0.05
Correlation with clinical parametersChi-square test, logistic regression, Spearman correlation SPSS, R Studio (v3.6.3)p < 0.05
Survival analysisUnivariate and multivariate Cox regression SPSS, R Studiop < 0.05
Enrichment analysisGO and KEGG enrichmentR package "clusterProfiler" (v3.15.3) p adjust ≤ 0.05

How should researchers organize and present Agtrap experimental data for maximum clarity?

When presenting Agtrap research data, follow these structured guidelines for optimal clarity:

How can researchers effectively interpret contradictory findings related to Agtrap function?

When confronted with contradictory findings regarding Agtrap function, consider these methodological approaches:

  • Context specificity: Agtrap function may vary significantly between different tissues, disease states, and experimental conditions. For example, while Agtrap deficiency shows minimal effects under standard diets, it leads to significant metabolic dysfunction under high-fat diet conditions .

  • Dosage effects: Consider whether contradictory findings might relate to different expression levels of Agtrap. Both complete knockout and overexpression models may show phenotypes that differ from subtle expression changes.

  • Temporal considerations: Short-term versus long-term alterations in Agtrap expression may produce different outcomes due to compensatory mechanisms.

  • Species and strain differences: Results from rat models may differ from mouse or human studies due to species-specific functions of Agtrap.

  • Experimental approach validation: When contradictory findings emerge, validate key experimental parameters:

    • Antibody specificity for Agtrap detection

    • Knockout model confirmation

    • Expression quantification methods

    • Statistical power and sample sizes

By systematically addressing these factors, researchers can reconcile apparently contradictory findings and develop a more nuanced understanding of Agtrap function in different contexts.

What are promising future research directions for Agtrap studies?

Based on current knowledge gaps, these research avenues show particular promise:

  • Tissue-specific functions: Further investigation of Agtrap's role in different tissues beyond adipose, particularly in cancer contexts where it shows prognostic value .

  • Therapeutic targeting: Development of approaches to modulate Agtrap expression or activity as a potential therapeutic strategy for metabolic disorders .

  • Molecular structure-function relationships: Detailed characterization of how Agtrap's molecular structure facilitates its interaction with AT1R and influences downstream signaling.

  • Clinical biomarker development: Validation of Agtrap as a biomarker in larger clinical cohorts across multiple cancer types .

  • Cross-talk with other signaling pathways: Investigation of how Agtrap-AT1R interactions influence or are influenced by other signaling pathways involved in metabolism and cancer.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.