Recombinant Rat Type 2 lactosamine alpha-2,3-sialyltransferase (St3gal6)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Biological Systems

St3gal6 regulates multiple physiological and pathological processes:

Leukocyte Trafficking and Inflammation

  • Selectin Ligand Synthesis: Cooperates with ST3Gal-IV to generate functional E-/P-selectin ligands on leukocytes. Double-deficient (St3gal4/St3gal6⁻/⁻) mice exhibit impaired neutrophil rolling and reduced lymphocyte homing .

  • Leukocytosis: Double deficiency increases circulating neutrophils by 80%, highlighting its role in leukocyte homeostasis .

Cancer Biology

  • Multiple Myeloma (MM): High ST3GAL6 expression correlates with poor MM patient survival. Knockdown reduces α-2,3-sialylation, impairing adhesion to bone marrow stromal cells and transendothelial migration .

  • Hepatocellular Carcinoma (HCC): Upregulated ST3GAL6 enhances cell proliferation and invasion via EGFR sialylation, activating PI3K/AKT pathways .

Neurological Disorders

  • Hepatic Encephalopathy (HE): Ammonia-induced ST3GAL6 upregulation in astrocytes promotes autophagy via HSPB8-BAG3 complex formation, suggesting a role in neurotoxicity .

Research Applications

A. In Vitro Assays
Recombinant St3gal6 is used to study sialylation kinetics. A standardized activity assay involves:

StepProtocol
Enzyme ReconstitutionDilute to 0.1–1.0 mg/mL in sterile water; add 50% glycerol for storage .
Activity MeasurementIncubate with CMP-sialic acid and N-acetyllactosamine; quantify phosphate release .
Specific ActivitySpecific Activity=Phosphate released (pmol)Time (min) × Enzyme (µg)\text{Specific Activity} = \frac{\text{Phosphate released (pmol)}}{\text{Time (min) × Enzyme (µg)}}

Therapeutic Targeting

  • Cancer: Inhibitors of ST3GAL6 reduce metastasis by blocking sLeX-dependent cell adhesion .

  • Neurodegeneration: Modulating ST3GAL6 activity may mitigate ammonia-induced autophagy in HE .

Gene and Protein Overview

GeneProtein
Gene NameSt3gal6 (Rat) / ST3GAL6 (Human)
SynonymsSIAT10, ST3GalVI, Sialyltransferase 10
Chromosomal LocationChromosome 3 (Rat) / Chromosome 3p21.31 (Human)
Substrate SpecificityGalβ1-4GlcNAc on glycoproteins, neolactotetraosylceramide
PathwaysGlycosphingolipid biosynthesis, selectin ligand synthesis

Key Research Findings

  • In Vivo Homing: ST3GAL6 knockdown in MM cells reduces bone marrow engraftment by 60% and prolongs survival in xenograft models .

  • Platelet Regulation: Combined St3gal4/St3gal6 deficiency reduces platelet counts to 16% of normal, increasing galactose exposure .

  • Autophagy Link: Ammonia-induced ST3GAL6 in astrocytes upregulates LC3 and Beclin-1, driving autophagosome formation .

Therapeutic Implications

  • Biomarker Potential: High ST3GAL6 expression in tumors correlates with advanced stages and poor prognosis .

  • Drug Development: Targeting ST3GAL6-mediated sialylation disrupts EGFR and integrin signaling, offering avenues for precision oncology .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes, and we will fulfill your requirement whenever possible.
Lead Time
Delivery time may vary based on your purchasing method and location. Please consult your local distributors for the most accurate delivery timeframe.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid form exhibits a shelf life of 6 months at -20°C/-80°C. Lyophilized form, on the other hand, typically maintains stability for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is essential for multiple uses. To minimize degradation, avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
St3gal6; Siat10; Type 2 lactosamine alpha-2,3-sialyltransferase; CMP-NeuAc:beta-galactoside alpha-2,3-sialyltransferase VI; ST3Gal VI; ST3GalVI; Sialyltransferase 10
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-331
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
St3gal6
Target Protein Sequence
MKGYVVAIFLSSIFLYYVLYCILWGTNGYWFPNEEMKSKNNVKNCFKKPAFASLLRFPQFYPFLCKADFVKVAATYGTNNFLLPYGVKTFESYFRSGLSKLQSCDLVGQFDTVPCKRCVVVGNGGVLKNKTLGAKIDSYDVIIRMNNGPVLGHEEEVGKRTTFRLFYPESVFSDPSHYDPNTTAVLVVFKPQDLRWLMEILIGKKINTDGFWKKPALKLIYKQYQIRILDPYIIREAAFQLLRFPRVFPKDQKPKHPTTGIIALTLAFHICSEVHLAGFKYNFYTPDSPLHYYGNATMSLMKKNAYHNLTAEQLFLKNLIKKKMVINLTQN
Uniprot No.

Target Background

Function
This enzyme plays a crucial role in the synthesis of sialyl-paragloboside, a precursor to the sialyl-Lewis X determinant. It exhibits alpha-2,3-sialyltransferase activity towards Gal-beta1,4-GlcNAc structures found on glycoproteins and glycolipids. This enzyme exhibits a restricted substrate specificity, acting on Gal-beta1,4-GlcNAc on glycoproteins, as well as neolactotetraosylceramide and neolactohexaosylceramide. However, it does not interact with lactotetraosylceramide, lactosylceramide, or asialo-GM1.
Database Links
Protein Families
Glycosyltransferase 29 family
Subcellular Location
Golgi apparatus membrane; Single-pass type II membrane protein.

Q&A

What is ST3GAL6 and what is its primary function in biological systems?

ST3GAL6 (Type 2 lactosamine alpha-2,3-sialyltransferase) is an enzyme that catalyzes the transfer of sialic acid from cytidine 5'-monophospho-N-acetylneuraminic acid (CMP-NeuAc) to form alpha 2-3 linked sialic acid specifically on Gal-beta 1,4-GlcNAc structures found on glycoproteins and glycolipids . This enzyme belongs to the ST3Gal subfamily of sialyltransferases and is also known as sialyltransferase 10 (ST3Gal VI or SIAT10) .

Biologically, ST3GAL6 plays critical roles in:

  • Immune cell recognition and trafficking

  • Cell adhesion processes

  • Synthesis of selectin ligands

  • Formation of sialyl Lewis x (sLex) determinants, important for cell-to-cell recognition

  • Modulation of cell signaling through selective sialylation of receptors such as EGFR

How does recombinant rat ST3GAL6 differ from ST3GAL6 from other species?

Recombinant rat ST3GAL6 (from Rattus norvegicus) shares structural and functional similarities with ST3GAL6 from other mammalian species, but has species-specific sequence variations. The rat ST3GAL6 consists of 331 amino acids with the UniProt accession number P61943 . While the core catalytic domain and substrate specificity remain largely conserved across species, subtle differences in amino acid composition may affect enzyme kinetics, thermal stability, and optimal reaction conditions.

The rat ST3GAL6 amino acid sequence includes characteristic domains common to sialyltransferases, including:

  • A transmembrane domain in the N-terminal region

  • A stem region that provides structural support

  • A highly conserved catalytic domain containing sialyl motifs essential for substrate binding and catalysis

When comparing experimental results, researchers should be aware that findings from rat ST3GAL6 studies may not translate perfectly to human systems due to these species-specific differences.

What are the typical expression systems used for producing recombinant ST3GAL6?

Recombinant ST3GAL6 can be produced in various expression systems, each with distinct advantages depending on the research application:

  • E. coli expression system: Commonly used for producing rat ST3GAL6 with His-tags for easy purification . While offering high yield and cost-effectiveness, bacterial expression may lack proper post-translational modifications.

  • Mammalian cell expression (HEK293): Provides proper protein folding and post-translational modifications, yielding functionally active enzyme. Often used for producing tagged versions (MYC/DDK-tagged) of human and mouse ST3GAL6 .

  • CHO cell expression: Chinese Hamster Ovary cells are particularly useful when studying glycosylation patterns and for applications requiring mammalian-type glycosylation .

The choice of expression system should be guided by the specific research needs. For structural studies, bacterial expression may be sufficient, while for functional studies requiring fully active enzyme, mammalian expression systems are preferable despite their higher cost and complexity.

How do ST3GAL6 and ST3GAL4 coordinate in selectin ligand synthesis and leukocyte trafficking?

ST3GAL6 and ST3GAL4 play coordinated roles in the synthesis of functional selectin ligands critical for leukocyte trafficking. Studies with knockout mice have revealed their overlapping yet distinct contributions:

These findings demonstrate that while both enzymes contribute to selectin ligand synthesis, they have partial redundancy and differential preferences for specific selectin ligand substrates, suggesting specialized roles in different inflammatory and immune contexts.

What is the role of ST3GAL6 in cancer biology and how might targeting this enzyme affect tumor progression?

ST3GAL6 has emerging significance in cancer biology through several mechanisms:

  • EGFR signaling modulation: Studies indicate that ST3GAL6 selectively sialylates EGFR (epidermal growth factor receptor), affecting downstream ERK and AKT signal transduction pathways. This sialylation positively correlates with cell proliferation and colony formation, suggesting a potential oncogenic role .

  • Contrast with other sialyltransferases: ST3GAL6's effect on EGFR signaling contrasts with ST3GAL4, which selectively sialylates beta 1 integrin rather than EGFR, highlighting the specificity of different sialyltransferases in cancer progression .

  • Potential therapeutic implications: The specific role of ST3GAL6 in EGFR sialylation suggests it could be a therapeutic target in cancers dependent on EGFR signaling. Inhibiting ST3GAL6 might reduce cancer cell proliferation by attenuating EGFR-mediated signaling.

  • Diagnostic potential: Changes in sialylation patterns mediated by ST3GAL6 could serve as biomarkers for cancer progression or response to therapy.

Future research directions include:

  • Developing specific inhibitors of ST3GAL6 as potential anti-cancer therapeutics

  • Exploring the correlation between ST3GAL6 expression and cancer patient outcomes

  • Investigating how ST3GAL6-mediated sialylation affects resistance to existing EGFR-targeted therapies

How does ST3GAL6 contribute to the formation of sialyl Lewis x (sLex) and what are the implications for inflammatory processes?

ST3GAL6 plays a critical role in the biosynthesis of sialyl Lewis x (sLex), a tetrasaccharide carbohydrate that functions as a key ligand for selectins:

  • Biosynthetic role: ST3GAL6 contributes to sLex formation by catalyzing the addition of α2,3-linked sialic acid to the terminal galactose residue of the type 2 lactosamine structure (Galβ1,4GlcNAc), which serves as the precursor for subsequent fucosylation to form complete sLex .

  • Specificity for glycoconjugates: ST3GAL6 shows high specificity for certain gangliosides and glycoproteins that serve as scaffolds for sLex, making it a key determinant of which cellular proteins carry this important carbohydrate epitope .

  • Inflammatory implications: As sLex is a crucial determinant of leukocyte rolling and adhesion during inflammation, ST3GAL6 activity directly affects:

    • The intensity and duration of inflammatory responses

    • Leukocyte recruitment to sites of infection or injury

    • Development of chronic inflammatory conditions when dysregulated

  • Coordination with fucosyltransferases: Complete sLex formation requires collaboration between ST3GAL6 and fucosyltransferases (particularly FUT7 and FUT4). The sequential action of these enzymes must be precisely regulated for proper sLex synthesis.

The importance of ST3GAL6 in sLex formation highlights its potential as a therapeutic target for inflammatory diseases. Modulating ST3GAL6 activity could potentially reduce excessive leukocyte recruitment in conditions like rheumatoid arthritis, inflammatory bowel disease, or atherosclerosis by limiting the availability of functional selectin ligands.

What are the optimal conditions for measuring recombinant rat ST3GAL6 enzyme activity in vitro?

Optimal conditions for measuring recombinant rat ST3GAL6 activity involve careful preparation of reaction components and appropriate assay conditions:

Enzyme preparation:

  • Use freshly prepared or properly stored recombinant ST3GAL6 (typically at -20°C with 50% glycerol for stability)

  • Dilute the enzyme to 20 μg/mL in an appropriate assay buffer (typically Tris-based)

  • Avoid repeated freeze-thaw cycles which can compromise enzyme activity

Reaction components:

  • CMP-Sialic Acid (donor substrate): 0.2-0.4 mM final concentration

  • N-Acetyllactosamine (acceptor substrate): 4-8 mM final concentration

  • Coupling Phosphatase (for coupled enzyme assays): 4 μg/mL

  • Assay Buffer: Typically Tris-based with optimized pH (7.0-7.5)

Reaction conditions:

  • Temperature: 37°C is optimal for enzymatic activity

  • Incubation time: 30 minutes for standard activity assays

  • pH: 7.0-7.5 (optimum for most sialyltransferases)

  • Divalent cations: Often requires Mg²⁺ or Mn²⁺ for optimal activity

Detection methods:

  • Malachite Green Assay (measuring released phosphate):

    • After the reaction period, add Malachite Green Reagents

    • Incubate 20 minutes at room temperature

    • Read absorbance at 620 nm

  • HPLC/MS methods for direct product detection

  • Radioactive assays using labeled CMP-sialic acid

Activity calculation:

Specific Activity (pmol/min/μg) =Phosphate released (nmol) × (1000 pmol/nmol)
Incubation time (min) × amount of enzyme (μg)

When optimizing these conditions, each parameter should be individually varied while keeping others constant to determine the optimal reaction conditions for your specific ST3GAL6 preparation.

How can researchers effectively validate the specificity of recombinant ST3GAL6 against different potential substrates?

Validating ST3GAL6 specificity requires systematic testing against various potential substrates using complementary approaches:

Substrate panel screening:

  • Prepare a panel of structurally related oligosaccharides (N-acetyllactosamine, various glycolipids, glycoproteins)

  • Test each substrate under identical reaction conditions

  • Calculate relative activity (velocity) for each substrate

  • Rank substrates by preference based on kinetic parameters (kcat/Km)

Competition assays:

  • Use a known good substrate at a fixed concentration

  • Add potential competing substrates at varying concentrations

  • Measure the inhibition of primary substrate sialylation

  • Calculate IC50 values to quantify relative binding affinities

Structural analysis of reaction products:

  • After the reaction, analyze the sialylated products using:

    • Mass spectrometry (MS) to confirm molecular weight changes

    • Nuclear Magnetic Resonance (NMR) to verify the α2,3-linkage specificity

    • HPLC separation with appropriate standards for quantitative comparison

Comparative analysis with other sialyltransferases:

  • Run parallel reactions with ST3GAL6 and related enzymes (ST3GAL4, ST3GAL3)

  • Compare substrate preferences to highlight ST3GAL6-specific activities

  • This approach is particularly valuable for distinguishing the roles of ST3GAL6 from ST3GAL4 in selectin ligand synthesis

Molecular docking and mutation studies:

  • Use site-directed mutagenesis to modify putative substrate binding sites

  • Test mutant enzymes against the substrate panel

  • Identify residues critical for specific substrate recognition

The experimental design should include appropriate controls:

  • Negative control (reaction without enzyme)

  • Positive control (known substrate)

  • Time-dependent analysis to ensure measurements are made in the linear range of enzyme activity

What methods are available for monitoring ST3GAL6 expression and activity in complex biological samples?

Monitoring ST3GAL6 expression and activity in complex biological samples requires specialized techniques that can detect the enzyme amidst other cellular components:

Expression level detection methods:

  • RT-qPCR:

    • Design specific primers for rat ST3GAL6 mRNA

    • Extract total RNA from tissues/cells

    • Perform reverse transcription and quantitative PCR

    • Normalize to appropriate housekeeping genes

  • Western blotting:

    • Use ST3GAL6-specific antibodies (monoclonal preferred for specificity)

    • Extract proteins using detergent-based buffers optimized for membrane proteins

    • Include appropriate controls (recombinant ST3GAL6 as positive control)

    • Detect using chemiluminescence or fluorescent secondary antibodies

  • Immunohistochemistry/Immunofluorescence:

    • Useful for tissue localization studies

    • Fix tissue samples to preserve enzyme localization

    • Use specific anti-ST3GAL6 antibodies with appropriate visualization methods

Activity detection in complex samples:

  • Lectin-based detection of α2,3-sialylated products:

    • Use Maackia amurensis lectin (MAL), which specifically binds α2,3-sialylated glycans

    • Apply to cell surfaces, tissue sections, or membrane extracts

    • Visualize using fluorescent or enzyme-conjugated detection systems

  • Metabolic labeling with modified sialic acids:

    • Treat cells with alkyne/azide-modified sialic acid precursors

    • Allow cellular incorporation into glycans

    • Detect incorporated modified sialic acids via click chemistry with fluorescent probes

    • Analyze by flow cytometry or imaging

  • Mass spectrometry glycomic profiling:

    • Release and purify glycans from biological samples

    • Analyze by MALDI-TOF or LC-MS/MS

    • Compare α2,3-sialylated glycan profiles between samples

    • Perform derivatization to distinguish α2,3 from α2,6 linkages

  • Selective enzyme inhibition:

    • Compare glycan profiles before and after treatment with ST3GAL6-specific inhibitors

    • The difference represents ST3GAL6-dependent sialylation

  • Immunoprecipitation followed by activity assay:

    • Pull down ST3GAL6 from complex samples using specific antibodies

    • Perform activity assays on the immunoprecipitated material

    • This approach isolates ST3GAL6 activity from other sialyltransferases

These methods can be used individually or in combination to provide comprehensive information about ST3GAL6 expression and activity in complex biological contexts.

What are common challenges when working with recombinant ST3GAL6 and how can they be addressed?

Working with recombinant ST3GAL6 presents several challenges that researchers should anticipate and address:

Enzyme stability issues:

  • Challenge: ST3GAL6 can lose activity during storage or experimental handling.

  • Solution: Store in 50% glycerol at -20°C or -80°C for extended storage . Avoid repeated freeze-thaw cycles. Consider adding protease inhibitors to prevent degradation. Prepare working aliquots for one-time use and maintain at 4°C for up to one week .

Low enzymatic activity:

  • Challenge: Insufficient activity in reaction assays.

  • Solution: Verify enzyme integrity by SDS-PAGE before experiments. Optimize reaction conditions (pH, temperature, metal ion concentrations). Ensure fresh CMP-sialic acid donor substrate as it can hydrolyze over time. Consider using higher enzyme concentrations (5-10 μg per reaction) for difficult substrates.

Substrate specificity and availability:

  • Challenge: Finding appropriate substrates for specific research questions.

  • Solution: For standard activity tests, use N-acetyllactosamine as a well-characterized acceptor . For specialized applications, synthesize or purchase specific oligosaccharides with Gal-beta 1,4-GlcNAc terminals. Test different substrate concentrations to find optimal ranges.

Detection sensitivity limitations:

  • Challenge: Difficulty detecting low levels of sialylation.

  • Solution: Use coupled enzyme assays with malachite green detection for higher sensitivity . Consider fluorescently-labeled substrates or radioactive assays for enhanced detection limits. For complex samples, employ mass spectrometry for precise identification of sialylated products.

Competing enzymatic activities in complex samples:

  • Challenge: Other sialyltransferases (especially ST3GAL4) may have overlapping activities.

  • Solution: Use selective inhibitors when available. Compare results from wild-type samples with those from St3gal6-knockout models . Consider using recombinant enzyme rather than tissue extracts for cleaner results.

Expression and purification issues:

  • Challenge: Low yield or impure enzyme preparations.

  • Solution: Optimize expression conditions (temperature, induction time, media composition). Use affinity tags (His, Fc chimera) for easier purification . Consider changing expression systems if bacterial expression gives inactive enzyme (mammalian cells often yield better results for glycosyltransferases).

Reproducibility problems:

  • Challenge: Variation between experiments or enzyme batches.

  • Solution: Standardize protocols rigorously. Include internal controls in each experiment. Characterize each new enzyme batch before use. Use the same substrate and donor lot numbers when comparing between experiments.

How can researchers optimize experimental design to distinguish between ST3GAL6 and other sialyltransferase activities in biological systems?

Distinguishing ST3GAL6 activity from other sialyltransferases requires strategic experimental design:

Genetic approaches:

  • CRISPR/Cas9 knockout or knockdown: Generate ST3GAL6-deficient cell lines or animal models to identify ST3GAL6-specific effects by comparison with wild-type controls .

  • Selective overexpression: Express recombinant ST3GAL6 in cells with low endogenous activity to identify gain-of-function effects.

  • Comparison with other knockouts: Use St3gal4/St3gal6 double-deficient models to distinguish unique vs. overlapping functions .

Biochemical discrimination:

  • Substrate preference analysis: ST3GAL6 has higher specificity for certain gangliosides and glycoproteins compared to other ST3Gal family members .

  • Kinetic analysis: Determine Km and Vmax values for ST3GAL6 using various substrates and compare with other sialyltransferases to identify preferential substrates.

  • pH and temperature optima: Characterize the enzyme under various conditions to find parameters that maximize ST3GAL6 activity while minimizing others.

Inhibitor-based approaches:

  • Selective inhibitors: When available, use ST3GAL6-specific inhibitors to block its activity selectively.

  • Differential inhibition: Use a panel of inhibitors with known specificity profiles against different sialyltransferases to deconvolute mixed activities.

Analytical techniques:

  • Linkage analysis: ST3GAL6 creates α2,3 linkages, so use linkage-specific lectins (MAL-II for α2,3 vs. SNA for α2,6) to differentiate sialylation types.

  • Mass spectrometry: Perform detailed structural analysis of sialylated products to identify specific glycan structures preferentially created by ST3GAL6.

  • Sequential enzyme treatments: Use specific exoglycosidases to selectively remove particular linkages and attribute remaining structures to specific enzymes.

Functional readouts:

  • Selectin binding assays: ST3GAL6 contributes to selectin ligand formation, so measure E-, P-, and L-selectin binding as functional readouts .

  • Cell adhesion and rolling assays: Use flow chamber assays to measure functional consequences of ST3GAL6 activity on leukocyte rolling behavior .

Experimental design matrix:

Experimental ApproachAdvantagesLimitationsBest Use Case
Genetic knockoutDefinitive attribution of functionPotential compensatory mechanismsDetermining in vivo significance
Recombinant enzyme assaysClean system, quantitativeMay not reflect in vivo complexityKinetic and mechanistic studies
Inhibitor studiesCan be applied to native systemsLimited by inhibitor specificityAcute intervention studies
Substrate specificity analysisIdentifies unique activitiesLabor intensiveDetailed biochemical characterization
Functional assaysConnects biochemistry to biologyMay involve multiple enzymesTranslational research

A comprehensive approach combining multiple methods provides the most reliable discrimination between ST3GAL6 and other sialyltransferase activities.

What quality control measures should be implemented when working with recombinant ST3GAL6 preparations?

Rigorous quality control is essential for ensuring reliable results when working with recombinant ST3GAL6:

Purity assessment:

  • SDS-PAGE analysis: Should show a predominant band at the expected molecular weight (67-81 kDa for ST3GAL6 Fc chimera under reducing conditions) .

  • Western blot confirmation: Use anti-ST3GAL6 antibodies or tag-specific antibodies (for His, Fc, or MYC/DDK-tagged proteins) to verify identity .

  • Mass spectrometry: For definitive identification and to detect potential contaminants or truncations.

Activity validation:

  • Specific activity determination: Calculate enzyme activity using standard substrates (N-acetyllactosamine) and established assay conditions .

  • Reference standard comparison: Include a well-characterized ST3GAL6 preparation as a positive control in activity assays.

  • Activity stability testing: Assess activity retention over time under various storage conditions.

Structural integrity:

  • Thermal shift assays: Monitor protein unfolding transitions to assess conformational stability.

  • Size exclusion chromatography: Detect aggregation or degradation products.

  • Native PAGE: Assess oligomeric state and structural integrity.

4. Glycosylation analysis (for mammalian-expressed ST3GAL6):

  • Lectin blotting: Assess presence and type of glycosylation.

  • PNGase F treatment: Compare enzyme before and after deglycosylation to determine impact on activity.

  • Mass spectrometry: Characterize site-specific glycosylation patterns.

5. Endotoxin testing (critical for in vivo applications):

  • LAL assay: Ensure preparations are endotoxin-free, especially for cell culture or animal studies.

Batch consistency monitoring:

  • Lot-to-lot comparison: Establish acceptance criteria for new batches based on:

    • Specific activity (should be within 15-20% of reference value)

    • Purity (typically >90% by densitometry)

    • Stability profile

Storage stability assessment:

  • Accelerated stability testing: Evaluate activity retention under stress conditions.

  • Real-time stability monitoring: Regular testing of activity during storage period.

  • Freeze-thaw stability: Determine activity loss after multiple freeze-thaw cycles.

Standard QC testing protocol:

TestMethodAcceptance CriteriaFrequency
IdentityWestern blotPositive at expected MWEach batch
PuritySDS-PAGE>90% by densitometryEach batch
ActivityEnzymatic assay>80% of reference standardEach batch
EndotoxinLAL assay<0.1 EU/μg proteinEach batch
StabilityActivity retention<20% loss after recommended storageQuarterly
GlycosylationLectin blotConsistent patternRepresentative batches

Implementing these quality control measures ensures that experimental results are attributable to the enzyme's properties rather than preparation artifacts, enhancing reproducibility and reliability of research findings.

How should researchers interpret differences in ST3GAL6 activity between in vitro assays and in vivo studies?

Interpreting differences between in vitro and in vivo ST3GAL6 activity requires careful consideration of multiple factors:

Factors contributing to in vitro vs. in vivo discrepancies:

  • Microenvironment complexity:

    • In vitro assays use purified components in optimized buffers

    • In vivo environments contain competing substrates, cofactors, and inhibitors

    • Solution: Validate findings using increasingly complex systems (purified enzyme → cell extracts → cell culture → animal models)

  • Substrate accessibility and presentation:

    • In vitro: Soluble, readily accessible substrates

    • In vivo: Substrates embedded in membranes or part of complex glycoprotein structures

    • Solution: Use membrane preparations or cell surface assays as intermediate validation steps

  • Enzyme regulation mechanisms:

    • In vitro: Constant enzyme concentration and activity

    • In vivo: Enzyme subject to transcriptional regulation, post-translational modifications, and compartmentalization

    • Solution: Study enzyme kinetics under different regulatory conditions

  • Compensatory mechanisms:

    • Studies with St3gal6-knockout mice reveal incomplete loss of selectin ligand function due to compensation by ST3GAL4

    • Solution: Use double knockout models (St3gal4/St3gal6) to remove compensatory effects

  • Temporal dynamics:

    • In vitro: Measured at a single timepoint

    • In vivo: Occurs in dynamic equilibrium with other processes

    • Solution: Conduct time-course studies in both systems

Interpretation guidelines:

  • When in vitro activity is higher than observed in vivo effects:

    • Consider inhibitory factors present in vivo

    • Evaluate subcellular localization (enzyme may not access all potential substrates)

    • Examine competition with other sialyltransferases for the same substrates

  • When in vivo effects exceed predicted in vitro activity:

    • Consider synergistic interactions with other enzymes or factors

    • Evaluate indirect effects (ST3GAL6 may influence other cellular processes)

    • Examine feedback loops that amplify initial enzymatic effects

  • Reconciliation approaches:

    • Use intermediate complexity models (cell cultures, tissue explants)

    • Perform substrate accessibility analyses in cellular contexts

    • Conduct systems biology approaches to model complex interactions

Case study from the literature:
Studies of leukocyte rolling in St3gal6-knockout mice showed impaired P-selectin-dependent rolling but normal E-selectin-dependent rolling, while in vitro binding assays showed reduced binding to both selectins . This discrepancy was resolved by considering the presence of alternative sialyltransferases (ST3GAL4) and the different threshold requirements for functional selectin binding in static versus dynamic conditions.

What are the implications of ST3GAL6 research for understanding glycosylation-related diseases and developing therapeutic interventions?

ST3GAL6 research has significant implications for understanding and treating diseases with aberrant glycosylation:

Inflammatory and immune disorders:

  • Research insights: ST3GAL6 is crucial for selectin ligand synthesis and leukocyte trafficking, as demonstrated in knockout models .

  • Disease relevance: Dysregulated ST3GAL6 activity may contribute to excessive leukocyte recruitment in inflammatory conditions like rheumatoid arthritis, inflammatory bowel disease, and asthma.

  • Therapeutic potential: Selective inhibition of ST3GAL6 could reduce inflammatory cell recruitment by decreasing functional selectin ligands while preserving essential immune surveillance functions mediated by other sialyltransferases.

Cancer progression and metastasis:

  • Research insights: ST3GAL6 selectively sialylates EGFR, affecting ERK and AKT signal transduction pathways that correlate with cell proliferation and colony formation .

  • Disease relevance: Altered sialylation patterns are hallmarks of malignancy, potentially enhancing tumor cell survival, immune evasion, and metastatic potential.

  • Therapeutic potential:

    • ST3GAL6 inhibitors could reduce EGFR signaling in cancers dependent on this pathway

    • Targeting ST3GAL6-mediated sialylation might reduce cancer cell adhesion and metastasis

    • Combination therapy with existing EGFR inhibitors might overcome resistance mechanisms

Infectious diseases:

  • Research insights: Sialylated glycans serve as receptors for many pathogens, including influenza viruses and bacterial toxins.

  • Disease relevance: ST3GAL6-mediated α2,3-sialylation can create binding sites for pathogens that recognize this specific linkage.

  • Therapeutic potential: Modulating ST3GAL6 activity could potentially alter host susceptibility to specific pathogens that bind α2,3-sialylated glycans.

Diagnostic applications:

  • Research findings: Different sialyltransferase expression profiles create disease-specific glycosylation signatures.

  • Clinical relevance: Changes in ST3GAL6 expression or activity could serve as biomarkers for disease progression or treatment response.

  • Diagnostic development: Antibodies or lectins specific for ST3GAL6-generated structures could enable non-invasive monitoring of disease states through glycomic profiling.

Biotechnology applications:

  • Research findings: The ability to manipulate recombinant ST3GAL6 activity allows for glycoengineering of proteins and cells .

  • Biopharmaceutical relevance: Controlling sialylation can improve therapeutic protein half-life and functionality.

  • Development opportunities: Using recombinant ST3GAL6 for in vitro glycoengineering of antibodies and other biologics to enhance their pharmacokinetic properties.

Challenges and considerations for therapeutic development:

AspectChallengePotential Solution
SpecificityST3GAL6 shares substrate preferences with other sialyltransferasesStructure-based design of highly selective inhibitors
DeliveryTargeting a Golgi-resident enzymeDevelopment of cell-permeable inhibitors or gene therapy approaches
RedundancyFunctional compensation by other sialyltransferasesRational combination approaches targeting multiple relevant enzymes
Side effectsGlobal inhibition may affect multiple glycoproteinsTissue-specific or substrate-directed approaches

The future of ST3GAL6-based therapeutics will likely involve highly specific modulators of enzyme activity, potentially directed at particular tissue compartments or cellular contexts where pathological sialylation plays a causal role in disease.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.