Recombinant Rat Type I iodothyronine deiodinase (Dio1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you have specific format requirements, please indicate them during order placement.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please specify it, and we will prioritize its use.
Synonyms
Dio1; Itdi1; Txdi1; Type I iodothyronine deiodinase; 5DI; DIOI; Type 1 DI; Type-I 5'-deiodinase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-257
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Dio1
Target Protein Sequence
MGLSQLWLWLKRLVIFLQVALEVATGKVLMTLFPERVKQNILAMGQKTGMTRNPRFAPDN WVPTFFSIQYFWFVLKVRWQRLEDRAEYGGLAPNCTVVRLSGQKCNVWDFIQGSRPLVLN FGSCTUPSFLLKFDQFKRLVDDFASTADFLIIYIEEAHATDGWAFKNNVDIRQHRSLQDR LRAAHLLLARSPQCPVVVDTMQNQSSQLYAALPERLYVIQEGRICYKGKPGPWNYNPEEV RAVLEKLCIPPGHMPQF
Uniprot No.

Target Background

Function

Recombinant Rat Type I iodothyronine deiodinase (Dio1) is responsible for the deiodination of thyroxine (T4) to triiodothyronine (T3) and the subsequent deiodination of T3 to 3,3'-diiodothyronine (T2).

Gene References Into Functions
  1. Estrogen deficiency impairs the induction of Dio1 in the pituitary, affecting growth hormone (GH) release during exercise. Acute Dio1 activation is crucial for exercise-induced GH response. PMID: 25874614
  2. Pituitary Dio1 and brown adipose tissue Dio2 responses are blunted in ovariectomized rats. PMID: 22815055
  3. Androgen deprivation impacts thyroid homeostasis, influencing Dio1 and Dio2 expression. PMID: 22956722
  4. Type 1 and 2 deiodinases may have distinct roles in white adipose tissue, regulating lipogenesis and lipolysis. PMID: 21397282
  5. Long-term exercise reduces liver retinoic acid receptor (RAR) concentrations and 5'-deiodinase activity. PMID: 19646447
  6. Mammary gland carcinoma increases type I iodothyronine 5'-deiodinase activity in rats. PMID: 11765219
  7. The Dio1 3'UTR plays a role in regulating mRNA stability and translational efficiency. PMID: 16230777
  8. Neonatal thyroxine treatment affects body weight, fat percentage, serum leptin, and thyroid function in rats. PMID: 18197581
  9. The epididymis shows the highest 5'-deiodinase activity in the male reproductive system. PMID: 18467445
  10. Reduced liver Dio1 and brown adipose tissue Dio2 may contribute to decreased T4-to-T3 conversion after exercise. PMID: 18539729
Database Links

KEGG: rno:25430

UniGene: Rn.87549

Protein Families
Iodothyronine deiodinase family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.
Tissue Specificity
Highly expressed in the liver, kidney and thyroid gland of adult rats.

Q&A

What is the structure and function of Type I iodothyronine deiodinase (Dio1)?

Type I iodothyronine deiodinase (Dio1) is a membrane-anchored homo-dimeric selenoprotein that shares the thioredoxin-fold structure with other deiodinase isoenzymes. It contains an N-terminal membrane-spanning domain and plays a crucial role in thyroid hormone metabolism by catalyzing the monodeiodination of the prohormone thyroxine (T4) . Dio1 can perform both outer ring deiodination (ORD) to produce the active hormone triiodothyronine (T3) and inner ring deiodination (IRD) to produce the inactive metabolite reverse T3 (rT3) . The enzyme contains a selenocysteine residue in its catalytic center (position 126 in human Dio1), which is essential for its optimal activity .

How does Dio1 differ from other deiodinase isoenzymes (Dio2 and Dio3)?

While all three deiodinase isoenzymes (Dio1, Dio2, and Dio3) are membrane-anchored selenoproteins sharing a thioredoxin-fold structure, they differ in tissue distribution, substrate specificity, and catalytic properties:

  • Dio1 is primarily expressed in liver, kidney, and thyroid, and can catalyze both outer and inner ring deiodination

  • Dio1 is uniquely sensitive to inhibition by propylthiouracil (PTU), which can be used to differentiate its activity from other deiodinases in experimental settings

  • Dio1 shows lower substrate affinity (higher Km) compared to Dio2

  • Dio1 and Dio3 in liver collectively contribute to the conversion of rT3 to 3,3'-T2

These differences allow researchers to design specific experimental approaches to isolate and study Dio1 activity in complex biological systems.

What are the physiological consequences of Dio1 deficiency?

Dio1 deficiency results in characteristic alterations in thyroid hormone metabolism. Research on both Dio1 knockout mice and humans with DIO1 mutations shows:

  • Elevated serum reverse triiodothyronine (rT3) levels

  • Increased rT3/T3 ratios, which serve as a diagnostic marker

  • Heterozygous Dio1-null mice display similar thyroid hormone profiles to humans with DIO1 mutations, including elevated rT3/T3 ratios

Recent identification of DIO1 pathogenic variants (p.Asn94Lys and p.Met201Ile) in humans has demonstrated that inherited D1 deficiency manifests with abnormal thyroid hormone metabolism without necessarily causing overt thyroid dysfunction .

What are the advantages and limitations of different expression systems for recombinant Dio1?

Several expression systems have been used for recombinant Dio1 production, each with distinct advantages and limitations:

Yeast (Saccharomyces cerevisiae)

  • Advantages: Higher protein yield (approximately 65 pmol/mg microsomal protein compared to 3 pmol/mg in rat liver microsomes), eukaryotic post-translational modifications

  • Limitations: The selenocysteine residue is often replaced with cysteine (Dio1 Cys), resulting in altered enzyme kinetics (10-fold increase in Km for rT3)

Insect cells

  • Advantages: Better selenoprotein expression, closer to native enzyme properties

  • Limitations: More complex and costly than yeast systems

Mammalian cells (COS7)

  • Advantages: Can express selenoprotein forms with properties closest to native enzyme

  • Limitations: Lower expression levels, more resource-intensive

Selection of the appropriate expression system should be based on research requirements, including whether native selenoprotein activity is essential or if a cysteine mutant is sufficient.

How can active Dio1 be purified while maintaining its enzymatic function?

Purification of active Dio1 presents challenges due to its membrane-bound nature. A methodological approach includes:

  • Selection of appropriate detergents for solubilization that maintain the native conformation

  • Inclusion of reducing agents throughout purification to protect the catalytic (seleno)cysteine from oxidation

  • For recombinant proteins with affinity tags, use of gentle elution conditions

  • Keeping the purified protein in buffer containing stabilizing agents

Since Dio1 is membrane-bound with an N-terminal membrane-spanning domain, traditional purification methods often lead to activity loss. Expression systems with higher protein yields, such as yeast expressing Dio1 Cys (~65 pmol/mg microsomal protein), facilitate purification by providing more starting material .

What are the critical factors for successful expression of selenocysteine-containing Dio1?

Expression of selenocysteine-containing Dio1 requires special consideration of the selenoprotein synthesis machinery:

  • Inclusion of the selenocysteine insertion sequence (SECIS) element in the expression construct

  • Supplementation of culture media with selenium

  • Co-expression of selenocysteine synthesis components when needed

  • Optimization of expression conditions to minimize premature termination at the UGA codon

When selenocysteine incorporation is challenging, researchers often use the Cys-for-Sec substitution (e.g., U126C in human Dio1), which produces a functional but less active enzyme with altered kinetic properties .

How can Dio1 activity be measured accurately in experimental settings?

Several methods exist for measuring Dio1 activity, with radioenzymatic assays being the most established:

Radioenzymatic Assay Protocol:

  • Prepare activity assay buffer (200 mM potassium phosphate buffer (pH 6.8), 2 mM EDTA, 328 μM NaOH, 2 μM rT3)

  • Add regenerating reductant (20 mM DTT or physiological reductants)

  • Use 100-125 μg membrane protein in 50 μL homogenization buffer

  • Incubate with 50 μL activity assay buffer for 1 hour at 37°C

  • Stop reaction with stopping solution (10% bovine serum albumin, 10 mM PTU)

  • Precipitate proteins with 10% ice-cold trichloroacetic acid

  • Centrifuge (10,000 rpm, 5 min, 4°C)

  • Transfer supernatant containing released 125I- to Dowex®50WX2 columns

  • Elute with 10% acetic acid

  • Calculate specific enzymatic activity as pmol of released 125I- per mg protein per minute

LC-MS/MS Method:
More recently, liquid chromatography-tandem mass spectrometry (LC-MS/MS) has been used to directly measure thyroid hormone metabolites, providing more detailed information on multiple deiodinase activities simultaneously .

What physiological reductants can be used in Dio1 assays, and how do they compare to DTT?

While dithiothreitol (DTT) is commonly used as a reducing agent in Dio1 assays, several physiological reductants can be employed:

ReductantEffectivenessNotes
DTT (20 mM)High (standard)Artificial reductant, may mask mechanistic details
Glutathione (GSH)ModeratePhysiological reductant that requires Cys124 for Dio1 reduction
Thioredoxin (TXN1)LimitedDoes not efficiently reduce Dio1 U126C
Glutaredoxin (GRX1)LimitedDoes not efficiently reduce Dio1 U126C

Research shows that glutathione can regenerate the enzyme through reduction of a selenenyl-sulfide formed between Cys124 and Sec126 during catalysis. Mutation of Cys124 in Dio1 prevents reduction by glutathione, while 20 mM DTT still regenerates the enzyme .

How can Dio1 activity be distinguished from other deiodinases in tissue preparations?

Distinguishing Dio1 activity from other deiodinases in tissue preparations is crucial for accurate measurement:

  • Use of specific inhibitors:

    • Propylthiouracil (PTU) selectively inhibits Dio1 and can be used to differentiate Dio1 activity from Dio2 and Dio3

    • Iopanoic acid (IOP) inhibits all three deiodinases (Dio1/2/3)

  • Substrate specificity:

    • Dio1 effectively deiodates rT3 to produce 3,3'-T2

    • Researchers can isolate Dio1 activity by blocking Dio3 in liver microsomes, then measuring conversion of rT3 to 3,3'-T2

  • Tissue selection:

    • Liver microsomes are rich in Dio1

    • Placental tissue has high Dio3 expression and can be used as a comparison

Example of differential inhibition: In liver microsome preparations, PTU treatment resulted in 3,3'-T2 levels of 2.2 ± 0.1 ng/ml (complete Dio1 inhibition) compared to 448.9 ± 16.0 ng/ml in control incubations with DMSO .

What amino acid residues are critical for Dio1 catalytic function?

Several amino acid residues play crucial roles in Dio1 catalytic function:

  • Selenocysteine 126 (Sec126) - The catalytic residue that abstracts iodonium (I+) from iodothyronine substrates

  • Cysteine 124 (Cys124) - Forms a selenenyl-sulfide with Sec126 during catalysis, essential for enzyme regeneration by glutathione

  • Threonine 125 (Thr125) - Essential hydroxyl group; mutation to alanine (T125A) completely inactivates the enzyme, while T125S maintains activity

  • Serine 123 (Ser123) - Contributes to but is not essential for activity; S123A mutation reduces but does not eliminate activity

  • Histidine 174 (His174) - Involved in the proton relay pathway from solvent to substrate

These residues are part of a conserved proton relay network that facilitates catalysis, with Thr125 playing an especially critical role in the hydrogen-bonded network .

How does the replacement of selenocysteine with cysteine affect Dio1 catalytic properties?

Replacement of the catalytic selenocysteine with cysteine (e.g., U126C in human Dio1, or D1 Cys in rat Dio1) significantly alters the enzyme's catalytic properties:

The cysteine-substituted enzyme retains catalytic activity but with altered kinetics, making it useful for structural studies while recognizing its limitations as a model for the native enzyme .

What is the proposed catalytic mechanism for Dio1, and how does it compare to other deiodinases?

The current understanding of the Dio1 catalytic mechanism involves:

  • The catalytic selenocysteine (Sec126) abstracts an iodonium (I+) from the iodothyronine substrate

  • A proton is donated to the substrate through a hydrogen-bonded relay network involving:

    • Threonine 125 (Thr125) hydroxyl group

    • Glutamate 156 (Glu156)

    • Histidine 174 (His174), which is exposed to solvent

    • Tyrosine 153 (Tyr153), which stabilizes the hydrogen-bonded network

  • During catalysis, a selenenyl-sulfide forms between Cys124 and Sec126

  • Glutathione reduces this selenenyl-sulfide, regenerating the active enzyme

What mutations in the DIO1 gene have been identified, and how do they affect enzyme function?

Two pathogenic missense variants in the human DIO1 gene have been identified:

VariantNucleotide ChangeProtein ChangegnomAD MAFEffect on Enzyme
1c.282C>Ap.Asn94Lys (N94K)0.000022-3 fold higher Km, lower substrate affinity
2c.603G>Ap.Met201Ile (M201I)0.000062-3 fold higher Km, slower enzyme velocity

These variants are classified as pathogenic according to ACMG/AMP 2015 guidelines, with various supporting evidence (PS3+PM1+PM2+PP1+PP2+PP3+PP4 for N94K and PS3+PM1+PM2+PP2+PP3+PP4 for M201I) .

Kinetic studies of the mutant D1 proteins demonstrate that both variants result in decreased substrate affinity and slower enzyme velocity, leading to abnormal thyroid hormone metabolism in affected individuals.

How can Dio1 knockout/knockdown models be used to study thyroid hormone metabolism?

Dio1 knockout/knockdown models provide valuable insights into the physiological roles of this enzyme:

Experimental approaches:

  • Dio1-KO mice - Complete knockout of Dio1 gene

  • Dio1-Het mice - Heterozygous knockout, modeling human heterozygous variants

  • siRNA or shRNA - For transient or stable knockdown in cell culture systems

Key findings from animal models:

  • Dio1-KO and Dio1-Het mice show elevated serum rT3 levels and increased rT3/T3 ratios

  • These models have confirmed that heterozygous Dio1 deficiency produces measurable effects on thyroid hormone metabolism

  • Animal models provide controls for studying the effects of environmental factors on Dio1 activity

Applications:

  • Studying compensatory mechanisms in thyroid hormone metabolism

  • Evaluating the effects of Dio1 inhibitors

  • Investigating tissue-specific consequences of Dio1 deficiency

  • Testing interventions to address abnormal thyroid hormone metabolism

How do environmental factors and chemical exposures affect Dio1 function?

Environmental factors and chemical exposures can significantly impact Dio1 function:

  • Pharmacological inhibitors:

    • Propylthiouracil (PTU) completely inhibits Dio1 activity (reducing 3,3'-T2 production from rT3 to 2.2 ± 0.1 ng/ml compared to 448.9 ± 16.0 ng/ml in controls)

    • Iopanoic acid (IOP) inhibits all deiodinases (Dio1/2/3), reducing 3,3'-T2 production to 2.6 ± 1.2 ng/ml

  • Environmental exposures:

    • IOP exposure in animal models shows dose-dependent reductions in Dio1 activity (51% ± 1.7 reduction at 1 mg/kg)

    • Higher IOP doses result in high rT3 levels (106-112 ng/ml), comparable to denatured microsomes (110 ng/ml)

    • These findings are consistent with increases in T4 in serum, confirming Dio1 inhibition

  • Physiological conditions:

    • Fasting or acute illness can cause transient decreases in D1 enzymatic activity, representing an adaptive response

    • These conditions produce a pattern of altered thyroid hormone metabolism similar to that seen in genetic Dio1 deficiency

How can the kinetics of Dio1 enzyme activity be accurately determined?

Accurate determination of Dio1 enzyme kinetics requires careful methodological considerations:

Experimental protocol for KM determination:

  • Prepare serial dilutions of substrate (e.g., 0.5-10 mM GSH or varying concentrations of rT3)

  • Incubate with protein samples for 1 hour at 37°C

  • Measure deiodination products using radioenzymatic assay or LC-MS/MS

  • Plot enzyme velocity versus substrate concentration

  • Fit data to appropriate enzyme kinetic models (Michaelis-Menten, Lineweaver-Burk, etc.)

Important considerations:

  • Use physiologically relevant conditions (pH 6.8, 37°C)

  • Ensure linearity of reaction by testing multiple time points

  • Account for background activity (use denatured enzyme controls)

  • Control for non-enzymatic deiodination

  • Consider cooperativity if present (Hill equation)

  • Determine if inhibitors act competitively or non-competitively

What are the best approaches for studying Dio1 protein-protein interactions and regulatory pathways?

Several approaches are valuable for studying Dio1 protein-protein interactions and regulatory pathways:

  • Co-immunoprecipitation - For identifying direct protein interactors

    • Can be coupled with mass spectrometry for unbiased identification

  • Crosslinking studies - To capture transient interactions

    • Chemical crosslinkers or photo-crosslinking approaches

  • Proteomic analysis of Dio1 complexes

    • Mass spectrometry to identify components of protein complexes

  • Yeast two-hybrid or mammalian two-hybrid systems

    • For screening potential interactors

  • Fluorescence resonance energy transfer (FRET)

    • For studying interactions in living cells

  • Site-directed mutagenesis

    • To identify critical residues for protein-protein interactions

    • Example: Mutation studies have revealed the importance of Cys124 in the interaction with glutathione

How can researchers design experiments to differentiate between the roles of Dio1, Dio2, and Dio3 in tissue samples?

Differentiating between the three deiodinase isoenzymes requires strategic experimental design:

  • Selective inhibition approaches:

    • Use PTU to selectively inhibit Dio1

    • Compare results with IOP, which inhibits all three deiodinases

    • The difference represents the contribution of Dio2 and Dio3

  • Substrate specificity analysis:

    • Dio1 effectively converts rT3 to 3,3'-T2

    • Dio2 primarily catalyzes T4 to T3 conversion

    • Dio3 inactivates T4 and T3 through inner ring deiodination

  • Tissue-specific expression patterns:

    • Liver microsomes are rich in Dio1

    • Brain and brown adipose tissue express high levels of Dio2

    • Placenta highly expresses Dio3

    • Design experiments using appropriate tissue sources based on this knowledge

  • Genetic approaches:

    • Use siRNA knockdown specific to each deiodinase

    • Employ tissue-specific conditional knockout models

    • Compare phenotypes across different knockout models

  • Combined analytical approaches:

    • Use LC-MS/MS to simultaneously measure multiple thyroid hormone metabolites

    • This allows tracking of specific pathways associated with each deiodinase

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.