Recombinant Rat UDP-glucuronosyltransferase 1-5 (Ugt1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50%, offered as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
Ugt1a5; Ugt1; UDP-glucuronosyltransferase 1A5; UGT1A5; B5; UDP-glucuronosyltransferase 1-5; UDPGT 1-5; UGT1*5; UGT1-05; UGT1.5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
26-531
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Ugt1a5
Target Protein Sequence
GKVLVFPMEGSHWLSMRDVVRELHARGHQAVVLAPEVTVHIKEEDFFTLQTYPVPYTRQG FRQQMMRNIKVVFETGNYVKTFLETSEILKNISTVLLRSCMNLLHNGSLLQHLNSSSFDM VLTDPVIPCGQVLAKYLGIPTVFFLRYIPCGIDSEATQCPKPSSYIPNLLTMLSDHMTFL QRVKNMLYPLALKYICHFSFTRYESLASELLQREVSLVEVLSHASVWLFRGDFVFDYPRP VMPNMVFIGGINCVIKKPLSQEFEAYVNASGEHGIVVFSLGSMVSEIPEKKAMEIAEALG RIPQTLLWRYTGTRPSNLAKNTILVKWLPQNDLLGHPKARAFITHSGSHGIYEGICNGVP MVMMPLFGDQMDNAKRMETRGAGVTLNVLEMTADDLENALKTVINNKSYKENIMRLSSLH KDRPIEPLDLAVFWVEYVMRHKGAPHLRPAAHDLTWYQYHSLDVIGFLLAIVLTVVFIVY KSCAYGCRKCFGGKGRVKKSHKSKTH
Uniprot No.

Target Background

Function

UDP-glucuronosyltransferase 1-5 (UGT1A5) is a phase II biotransformation enzyme that conjugates lipophilic substrates with glucuronic acid. This increases water solubility and facilitates urinary or biliary excretion. UGT1A5 is crucial for eliminating and detoxifying drugs, xenobiotics, and endogenous compounds. It is involved, for example, in the glucuronidation of zolarsatan, an angiotensin receptor antagonist.

Database Links

UniGene: Rn.26489

Protein Families
UDP-glycosyltransferase family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

What is the molecular structure and characteristics of Recombinant Rat UDP-Glucuronosyltransferase 1A1?

Recombinant Rat UDP-Glucuronosyltransferase 1 Family, Polypeptide A1 (UGT1A1) is typically expressed in E. coli as a prokaryotic protein with a molecular weight of approximately 16 kDa . The commercially available recombinant protein usually encompasses the expression region Ile62~Ala170 and includes an N-terminal His Tag for purification and detection purposes . The protein demonstrates >90% purity when analyzed by SDS-PAGE and contains endotoxin levels below 1.0 EU per 1μg when measured by the LAL method .

UGT1A1 is known by several synonyms including UGT1, GNT1, UGT1A, UDPGT, HUG-BR1, UGT1-1, Bilirubin-specific UDPGT isozyme 1, and UDP-glucuronosyltransferase 1-1 . The rat UGT1A1 protein has a Gene ID of 24861 and corresponds to Accession Number Q64550 in protein databases .

What are the optimal storage and handling conditions for maintaining Recombinant Rat UGT1A1 activity?

For optimal preservation of enzymatic activity, Recombinant Rat UGT1A1 should be stored at -20°C in a buffer typically consisting of PBS at pH 7.4 containing 0.01% SKL and 5% trehalose as stabilizing agents . Researchers should strictly avoid repeated freeze/thaw cycles as these can significantly compromise protein integrity and enzyme activity .

When working with the recombinant protein, it is advisable to aliquot the stock solution upon initial thawing to minimize the need for repeated freezing. For experiments requiring precise enzymatic measurements, it is recommended to use freshly thawed aliquots and maintain the protein at 4°C during short-term experimental procedures.

How do rat UGT1 family enzymes differ from human UGT1 enzymes in terms of substrate specificity?

Rat and human UGT1 family enzymes exhibit notable species differences in substrate specificity and catalytic efficiency. For instance, when examining the glucuronidation of diclofenac, human UGT1A9 catalyzes this reaction at a moderate rate of 166 pmol/min/mg protein, while human UGT1A6 shows significantly lower activity (<20 pmol/min/mg protein) .

By contrast, the rat orthologous enzymes demonstrate different substrate preferences and catalytic rates. For example, while human UGT2B7 is the predominant isoform responsible for diclofenac glucuronidation in humans (>500 pmol/min/mg protein), the orthologous rat enzyme UGT2B1 catalyzes this reaction at a rate of 250 pmol/min/mg protein . These species differences are crucial considerations when extrapolating experimental results from rat models to human applications.

What are the recommended methods for measuring UGT1A1 enzymatic activity in vitro?

For quantitative assessment of UGT1A1 activity in vitro, researchers typically employ HPLC or LC-MS/MS-based assays using specific substrates. The enzyme kinetics of UGT1A1 can be characterized by determining parameters such as Km and Vmax values. Based on the literature, enzyme kinetic studies with rat liver microsomes show that UGT enzymes involved in glucuronidation typically have low apparent Km values (<20 μM) and high Vmax values (approximately 0.9 nmol/min/mg protein) .

A standard activity assay methodology involves:

  • Incubation of recombinant UGT1A1 (5-10 μg protein) with a specific substrate (e.g., bilirubin for UGT1A1)

  • Addition of UDP-glucuronic acid as the co-substrate (typically 2-5 mM)

  • Incubation at 37°C for 15-30 minutes in a suitable buffer system (pH 7.4)

  • Termination of the reaction with acidification or organic solvent

  • Quantification of glucuronide formation by HPLC or LC-MS/MS

How can researchers control for splice variant expression when working with UGT1A1?

Controlling for splice variant expression is critical when working with UGT1A1, as tissue-specific splicing patterns can significantly influence experimental outcomes. Research has shown that UGT1A1 has multiple splice variants with tissue-specific distribution patterns . For instance, the UGT1A1-201 transcript (ENST00000305208) constitutes approximately 95% of the total UGT1A1 transcript pool in the liver, but only 73% in the small intestine and merely 3% in the kidney .

To control for splice variant expression, researchers should:

  • Quantify transcript abundance using isoform-specific qPCR primers targeting unique exon junctions

  • Validate protein expression of specific isoforms using targeted proteomic approaches

  • Consider tissue-specific expression patterns when designing experiments and interpreting results

  • For recombinant protein studies, clearly define which splice variant is being expressed

What experimental design considerations are important when studying UGT1 induction by xenobiotics?

When investigating UGT1 induction by xenobiotics, several key experimental design considerations are essential:

  • Selection of transcription factor activators: UGT1 genes are regulated by multiple xenobiotic-responsive transcription factors including AhR, CAR, PXR, PPARα, and Nrf2 . Selective activators for each pathway should be carefully chosen.

  • Treatment duration and dosing: Standard protocols often involve 3-4 consecutive days of treatment to achieve maximal induction . Dose-response relationships should be established to identify optimal concentrations.

  • Tissue specificity: UGT1 induction patterns differ between hepatic and intestinal tissues, necessitating examination of multiple tissues when assessing systemic effects .

  • Species differences: Significant species variations exist in response to inducers, with rat UGTs showing different induction profiles compared to human UGTs.

  • RNA and protein level verification: Induction should be confirmed at both mRNA (using qRT-PCR) and protein levels (using Western blotting and activity assays) to account for post-transcriptional regulation.

How do polymorphisms in rat UGT1A1 compare to human UGT1A1 variants, and what are the implications for translational research?

Rat and human UGT1A1 exhibit different polymorphic patterns that can significantly impact translational research. While human UGT1A1 has well-characterized polymorphisms like UGT1A1*28 (associated with Gilbert's syndrome), rat UGT1A1 polymorphisms have different distributions and functional consequences.

When conducting translational research, considerations should include:

  • Verification of functional conservation between rat and human UGT1A1 for the specific substrate under investigation

  • Assessment of whether polymorphisms affect the same functional domains across species

  • Comparison of enzyme kinetics (Km and Vmax) between rat and human variants using identical experimental conditions

  • Evaluation of species-specific post-translational modifications that may influence enzyme activity

These differences underscore the importance of validating findings from rat models in human systems before making translational claims.

What are the methodological approaches for studying the interplay between UGT1 enzymes and drug transporters?

The functional interaction between UGT1 enzymes and drug transporters represents a sophisticated area of research requiring specialized methodological approaches:

What techniques are recommended for investigating UGT1 splice variant regulation in different tissues?

Investigating tissue-specific regulation of UGT1 splice variants requires sophisticated molecular techniques:

  • RNAseq analysis: Deep sequencing allows for comprehensive identification of splice variants across tissues. Studies have revealed tissue-specific compositions of UGT1A1 splice isoforms, with UGT1A1-201 comprising 95% of hepatic transcripts but only 3% of kidney transcripts .

  • Exon-junction specific qPCR: Design of primers spanning unique exon junctions enables quantification of specific splice variants. This approach should be validated against RNAseq data.

  • Minigene assays: Construction of minigene constructs containing UGT1 exons and intronic regions allows for investigation of splicing regulatory elements in different cellular contexts.

  • RNA-protein interaction studies: Techniques such as RNA immunoprecipitation (RIP) or crosslinking immunoprecipitation (CLIP) can identify tissue-specific RNA-binding proteins that regulate alternative splicing of UGT1 transcripts.

  • Targeted proteomics: Development of splice variant-specific antibodies or MS-based approaches can confirm that tissue-specific splice variants are translated into functional proteins.

What are the common issues affecting recombinant UGT1 enzyme activity and how can they be addressed?

Several factors can compromise the activity of recombinant UGT1 enzymes:

  • Protein denaturation: Multiple freeze-thaw cycles can lead to decreased activity. Solution: Aliquot the enzyme upon first thawing and store at -20°C .

  • Improper reaction conditions: UGT1 enzymes require specific pH and buffer conditions. Solution: Maintain reactions at pH 7.4 in appropriate buffer systems containing divalent cations (typically Mg²⁺).

  • Co-substrate limitations: Insufficient UDP-glucuronic acid can limit reaction rates. Solution: Ensure adequate co-substrate concentration (typically 2-5 mM) in reaction mixtures.

  • Substrate solubility issues: Many UGT1 substrates have limited water solubility. Solution: Use appropriate solubilizing agents (e.g., DMSO) at concentrations that do not inhibit enzyme activity (typically <1% v/v).

  • Endogenous inhibitors: Sample matrices may contain inhibitory compounds. Solution: Implement appropriate sample cleanup procedures and include control reactions to assess inhibition.

How can researchers validate the specificity and reproducibility of UGT1A1 activity assays?

Ensuring specificity and reproducibility in UGT1A1 activity assays requires rigorous validation:

  • Substrate specificity verification: Utilize known specific substrates for UGT1A1 (e.g., bilirubin) and compare activity with other UGT isoforms.

  • Inhibitor studies: Employ selective UGT1A1 inhibitors to confirm the specific contribution of this isoform to the observed glucuronidation activity.

  • Inter-laboratory standardization: Use commercial reference standards and standardized protocols to enable comparison between laboratories.

  • Quality control samples: Include positive and negative controls in each assay batch to monitor assay performance over time.

  • Method validation: Establish and document critical parameters including linearity, precision, accuracy, and limits of detection/quantification for each substrate and matrix combination.

What strategies can be employed to overcome the challenges of expressing functional membrane-bound UGT1 enzymes in heterologous systems?

Expression of functional membrane-bound UGT1 enzymes presents several challenges that can be addressed using specific strategies:

  • Optimization of expression systems: While E. coli is commonly used for producing recombinant UGT fragments , mammalian or insect cell expression systems often provide better results for full-length, functional UGT1 enzymes.

  • Membrane solubilization: Carefully selected detergents (e.g., CHAPS, digitonin) can solubilize UGT1 enzymes while preserving activity. Detergent screening is often necessary to identify optimal conditions.

  • Co-expression of chaperones: Co-expression with molecular chaperones can improve folding and functional expression of UGT1 enzymes.

  • N-terminal modifications: Modification or truncation of the N-terminal domain can improve expression while maintaining catalytic function.

  • Microsomal preparation methods: For cell-based expression systems, optimized methods for microsomal preparation can yield higher activity enzymes suitable for detailed kinetic studies.

How can emerging technologies advance our understanding of UGT1 enzymes in complex biological systems?

Emerging technologies are opening new avenues for UGT1 research:

  • CRISPR/Cas9 gene editing: Precise modification of UGT1 genes in cell lines and animal models enables detailed structure-function studies and creation of humanized rat models.

  • Single-cell transcriptomics: Examination of UGT1 expression at the single-cell level reveals previously unrecognized heterogeneity within tissues that may have functional significance.

  • Cryo-EM structural analysis: Advances in structural biology techniques are beginning to provide detailed structural information about membrane-bound UGT enzymes that was previously unobtainable.

  • Organ-on-chip technology: Microfluidic systems incorporating hepatocytes and intestinal cells can model the interplay between UGT1-mediated metabolism and physiological processes.

  • Systems biology approaches: Integration of transcriptomic, proteomic, and metabolomic data is revealing complex regulatory networks controlling UGT1 expression and activity in response to physiological and xenobiotic stimuli.

What are the current challenges in translating findings from rat UGT1 studies to human applications?

Translating findings from rat UGT1 studies to human applications faces several challenges:

  • Species differences in catalytic properties: Rat and human UGT1 enzymes show different substrate specificities and kinetic parameters. For example, while rat UGT2B1 and human UGT2B7 both metabolize diclofenac, they exhibit different Vmax values (0.3 and 2.8 nmol/min/mg, respectively) .

  • Regulatory element variations: Transcriptional regulation of UGT1 genes differs between species, affecting responses to inducers and inhibitors.

  • Splice variant diversity: The pattern and functional significance of splice variants varies between rats and humans, with human UGT1A1 showing tissue-specific isoform distributions that may not be replicated in rat models .

  • Polymorphic variants: The prevalence and functional impact of genetic polymorphisms differ significantly between rat and human populations.

  • Physiological context: Differences in physiology, including bile composition and enterohepatic circulation, can affect the in vivo significance of UGT1-mediated metabolism.

Addressing these challenges requires careful experimental design and validation of findings across species before making translational claims.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.