Recombinant Rat UDP-glucuronosyltransferase 2A1 (Ugt2a1)

Shipped with Ice Packs
In Stock

Description

Enzymatic Functions

UGT2A1 catalyzes glucuronidation, conjugating UDP-glucuronic acid to substrates, enhancing their water solubility for excretion.

Key substrates and activities:

Substrate CategoryExamplesActivity (V<sub>max</sub>/K<sub>M</sub>)Source
Xenobiotics1-Naphthol, 3-Hydroxybenzo[a]pyreneIncreased glucuronidation
Endogenous compoundsTestosterone, 5α-androstane-3α,17β-diolModerate activity
Environmental toxinsBisphenol A, Bisphenol S, Bisphenol FDose-dependent glucuronidation

Host Systems and Expression Optimization

Recombinant UGT2A1 is produced in multiple systems with distinct advantages:

Host SystemPurityApplications
Baculovirus-infected insect cells≥85%Activity assays for PAHs and steroids
Mammalian cells≥85%Structural studies and kinetic analysis
E. coli≥85%High-yield production for biochemical assays

Tissue-Specific Expression

  • High expression: Olfactory mucosa (OM), lung, trachea, and colon .

  • Low/no expression: Liver, kidney, or brain .

  • Developmental regulation: Expression peaks at 3 months in rat olfactory bulb (OB), declining thereafter .

Polymorphism Impact

  • UGT2A1 75Arg308Gly: 25% reduction in V<sub>max</sub>/K<sub>M</sub> for PAHs compared to wild-type .

  • UGT2A1 75Lys308Arg: Complete loss of activity for all tested substrates .

Detoxification Roles

  • Tobacco carcinogens: Metabolizes polycyclic aromatic hydrocarbons (PAHs) like benzo[a]pyrene-7,8-diol .

  • Odorant clearance: Co-expressed with UGT1A6 in rat OM and OB, providing complementary detoxification pathways .

Applications in Toxicology and Pharmacology

  • Chemical risk assessment: Used to evaluate glucuronidation rates of endocrine disruptors (e.g., bisphenols) .

  • Drug metabolism: Screens for interactions with pharmaceuticals like indomethacin and amitriptyline .

  • Polymorphism studies: Links genetic variants (e.g., UGT2A1 75Arg308Gly) to altered detoxification capacity and disease susceptibility .

Regulatory and Inducer Responses

  • Upregulation: Dexamethasone increases UGT2A1 mRNA in rat OM .

  • No effect: Phenobarbital, Aroclor 1254, and ethoxyquin show negligible induction .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery timelines, please contact your local distributor.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize its development accordingly.
Synonyms
Ugt2a1; Ugt2a-1; UDP-glucuronosyltransferase 2A1; UDPGT 2A1; UGT2A1; UGT-OLF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
21-527
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Ugt2a1
Target Protein Sequence
GNVLIWPMEGSHWLNVKIIIDELLRKEHNVTVLVASGALFITPSVSPSLTFEIYPVPFGKEKIESVIKDFVLTWLENRPSPSTIWTFYKEMAKVIEEFHLVSRGICDGVLKNEKLMTKLQRGKFEVLLSDPVFPCGDIVALKLGIPFIYSLRFSPASTVEKHCGKVPFPPSYVPAILSELTDQMSFADRVRNFISYRMQDYMFETLWKQWDSYYSKALGRPTTLCETMGKAEIWLMRTYWDFEFPRPYLPNFEFVGGLHCKPAKPLPKEMEEFVQTSGEHGVVVFSLGSMVKNLTEEKANLIASALAQIPQKVLWRYKGKIPATLGSNTRLFDWIPQNDLLGHPKTRAFITHGGTNGIYEAIYHGIPMVGVPMFADQPDNIAHMKAKGAAVEVNMNTMTSADLLSAVRAVINEPFYKENAMRLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHDLSWFQYHSLDVIGFLLACMASAILLVIKCCLFVFQKIGKTXKKNKRD
Uniprot No.

Target Background

Function
UDP-glucuronosyltransferase (UGT) catalyzes phase II biotransformation reactions where lipophilic substrates are conjugated with glucuronic acid. This process enhances the metabolite's water solubility, facilitating excretion through urine or bile. UGT plays a crucial role in the elimination and detoxification of drugs, xenobiotics, and endogenous compounds. It catalyzes the glucuronidation of endogenous steroid hormones such as androgens (testosterones) and estrogens (estradiol and estriol). UGT contributes to bile acid (BA) detoxification by catalyzing the glucuronidation of BA substrates, which are natural detergents involved in dietary lipid absorption. UGT demonstrates high affinity for aliphatic odorants like citronellol and exhibits olfactory tissue specificity, potentially indicating a role in olfaction.
Database Links

KEGG: rno:63867

UniGene: Rn.138121

Protein Families
UDP-glycosyltransferase family
Subcellular Location
Membrane; Single-pass type I membrane protein.
Tissue Specificity
Olfactory epithelium. Mainly found in the sustentacular cells and to a lesser extent in Bowman's gland cells. Also expressed in the olfactory sensory neuron nuclei. Neuronal localization within the olfactory bulb is mainly found in the deeper granular cel

Q&A

What is the tissue expression profile of Ugt2a1 in rats?

Rat Ugt2a1 shows a distinctive tissue distribution pattern with predominant expression in the olfactory system. The enzyme is widely expressed among cells constituting the olfactory mucosa (OM) tissue . Additionally, Ugt2a1 is expressed in rat olfactory bulb (OB), although at lower levels compared to OM . This expression pattern suggests that Ugt2a1 plays a crucial role in the detoxification of xenobiotics entering through the nasal cavity, acting as a protective barrier for the brain. Expression studies should utilize quantitative RT-PCR with tissue-specific primers targeting the unique regions of Ugt2a1 to avoid cross-reactivity with other UGT isoforms.

How does rat Ugt2a1 expression change with age?

Ugt2a1 expression in rats demonstrates significant age-dependent variation. In the olfactory bulb, Ugt2a1 mRNA expression levels increase progressively in rats from birth to approximately 3 months of age, followed by a gradual decline thereafter . This age-dependent expression pattern suggests developmental regulation of Ugt2a1, potentially correlating with the maturation of the olfactory system. When designing experiments to study Ugt2a1, researchers should carefully consider the age of the animal models to ensure consistency and reproducibility of results.

What is the substrate specificity of recombinant rat Ugt2a1?

Recombinant rat Ugt2a1 demonstrates broad substrate specificity with preference for structurally diverse compounds. The enzyme primarily catalyzes the glucuronidation of odorant compounds, including numerous phenol derivatives, aliphatic compounds, and monoterpenoids . Additionally, Ugt2a1 accepts various endogenous steroids as substrates, including testosterone, 5α-androstane-17β-ol-3-one, and 5α-androstane-3α-17β-diol . When characterizing substrate specificity, researchers should employ a diverse panel of potential substrates and analyze reaction products using sensitive analytical techniques such as HPLC-MS/MS to comprehensively evaluate glucuronidation activity.

What are the optimal expression systems for producing functional recombinant rat Ugt2a1?

The production of enzymatically active recombinant rat Ugt2a1 requires careful consideration of expression systems. Baculovirus-infected insect cells represent an effective expression system for UGT enzymes, as demonstrated for human UGT2A enzymes . This system provides appropriate post-translational modifications and membrane integration essential for UGT activity. Alternative expression platforms include mammalian cell lines (HEK293, CHO cells) and yeast systems (Pichia pastoris).

For optimal expression, the following methodological considerations are critical:

  • Codon optimization for the host expression system

  • Inclusion of appropriate signal sequences for membrane targeting

  • Co-expression with UDP-glucose pyrophosphorylase to ensure sufficient UDP-glucuronic acid supply

  • Careful selection of detergents for enzyme solubilization to maintain activity

  • Verification of protein folding and glycosylation status

Enzyme activity should be validated using established substrates with known glucuronidation profiles to confirm functional expression.

How can researchers differentiate between Ugt2a1 and Ugt2a2 activity in rat tissues?

Distinguishing between the activities of Ugt2a1 and Ugt2a2 in rat tissues presents significant challenges due to their structural similarity and overlapping substrate specificity. Based on human UGT2A studies, these enzymes share exons 2-6, with only exon 1 being unique . A comprehensive approach to differentiate their activities includes:

  • Development of isoform-specific antibodies targeting the unique N-terminal regions encoded by exon 1

  • Design of selective substrate probes with differential affinities for each isoform

  • Implementation of isoform-selective inhibition strategies

  • Utilization of precise RT-PCR assays targeting the unique exon 1 sequences

  • CRISPR-Cas9 mediated selective knockout of each isoform in cell models

When interpreting results from rat tissues expressing both isoforms, researchers should consider the potential contribution of each enzyme to the observed glucuronidation activities.

What are the mechanisms regulating rat Ugt2a1 gene expression?

The regulation of rat Ugt2a1 gene expression involves complex mechanisms influenced by various factors. Transcriptional control of Ugt2a1 is modulated by specific xenobiotic-response transcription factors (XRTFs), including:

  • Glucocorticoid receptor - mediating upregulation by dexamethasone (DM)

  • Aryl hydrocarbon receptor

  • Nuclear factor E2-related factor 2

  • Peroxisome proliferator-activated receptor

  • Pregnane X receptor

Notably, Ugt2a1 mRNA expression is upregulated by dexamethasone, whereas no modulation effect has been observed with phenobarbital, Aroclor 1254, methylcholanthrene, or ethoxyquin . These regulatory patterns differ from those of Ugt1a6, highlighting the distinct transcriptional control mechanisms for different UGT isoforms.

To investigate these regulatory mechanisms, researchers should employ:

  • Promoter-reporter assays to identify responsive elements

  • Chromatin immunoprecipitation to confirm transcription factor binding

  • Site-directed mutagenesis to validate functional regulatory elements

  • Pharmacological modulators of specific signaling pathways

How does rat Ugt2a1 contribute to neuroprotection in the olfactory system?

Rat Ugt2a1, along with Ugt1a6, contributes significantly to neuroprotection in the olfactory system by functioning as a metabolic barrier against potentially toxic compounds. The olfactory bulb (OB) serves as an additional line of defense against toxic substances targeting cerebral tissue, with Ugt2a1 playing a crucial role in this protective mechanism .

The neuroprotective functions of Ugt2a1 can be investigated through:

Research methodologies should incorporate both in vivo approaches using rat models and in vitro systems with primary olfactory neurons or organotypic cultures.

What are the optimal conditions for assaying recombinant rat Ugt2a1 activity in vitro?

Establishing optimal conditions for assaying recombinant rat Ugt2a1 activity requires careful optimization of multiple parameters:

Buffer Components and pH:

  • TRIS-HCl buffer (50-100 mM) at pH 7.4-7.6

  • MgCl₂ (5-10 mM) as a cofactor

  • β-Mercaptoethanol or DTT (1-5 mM) to maintain reducing conditions

Membrane Preparation:

  • Differential centrifugation of recombinant cell lysates

  • Determination of protein concentration (Bradford or BCA assay)

  • Alamethicin treatment (50 μg/mg protein) to permeabilize vesicles

Reaction Conditions:

  • UDP-glucuronic acid concentration: 2-5 mM

  • Substrate concentration: spanning Km values (typically 10-1000 μM)

  • Incubation temperature: 37°C

  • Reaction time: linear range determination (typically 15-60 minutes)

Analytical Methods:

  • HPLC-UV/fluorescence for standard substrates

  • LC-MS/MS for comprehensive metabolite identification

  • Radiometric assays using ¹⁴C-labeled UDP-glucuronic acid

Enzyme kinetic parameters (Km, Vmax) should be determined under conditions ensuring linearity with respect to time and protein concentration.

What strategies can be employed to improve the solubility and stability of recombinant rat Ugt2a1?

As a membrane-bound enzyme, recombinant rat Ugt2a1 presents challenges related to solubility and stability. Researchers can implement the following strategies:

  • Co-expression with molecular chaperones:

    • BiP/GRP78 to assist folding in the endoplasmic reticulum

    • PDI to facilitate disulfide bond formation

  • Fusion tags and constructs:

    • N-terminal signal sequences for proper membrane targeting

    • C-terminal stabilizing tags (His-tag, GST) for purification

    • Truncation of transmembrane domains for increased solubility

  • Storage conditions optimization:

    • Addition of glycerol (20-30%) to storage buffer

    • Inclusion of protease inhibitors

    • Flash freezing in liquid nitrogen and storage at -80°C

  • Membrane preparation techniques:

    • Gentle detergent solubilization (CHAPS, Triton X-100)

    • Liposome reconstitution for enhanced stability

    • Nanodiscs formation for maintaining native conformation

  • Activity preservation:

    • Supplementation with phospholipids (phosphatidylcholine)

    • Addition of antioxidants to prevent oxidative damage

    • pH stabilization with appropriate buffering systems

These approaches should be empirically tested and optimized for specific experimental applications.

How does rat Ugt2a1 functionally compare with human UGT2A1 in terms of substrate specificity and catalytic efficiency?

While rat Ugt2a1 and human UGT2A1 share significant functional similarities, important differences exist in their substrate specificity and catalytic properties:

ParameterRat Ugt2a1Human UGT2A1Methodological Considerations
Tissue ExpressionPredominantly in olfactory mucosa and bulbPrimarily in olfactory tissuesUse of species-specific primers for qRT-PCR
Odorant MetabolismBroad specificity for monoterpenoids and phenolic odorantsSimilar profile but with quantitative differencesComparative enzyme kinetics with diverse odorant panels
Steroid GlucuronidationActive toward multiple androgensMore selective patternLC-MS/MS for comprehensive metabolite profiling
Regulatory MechanismsDexamethasone-inducibleDifferent xenobiotic response elementsSpecies-specific promoter analysis
Catalytic EfficiencyGenerally higher for phenolic substratesVariable substrate-dependent patternsDetermination of Vmax/Km ratios under identical conditions

When conducting comparative studies, researchers should:

  • Express both enzymes in the same recombinant system

  • Maintain identical reaction conditions

  • Utilize multiple substrate concentrations for accurate kinetic determinations

  • Consider species differences in co-substrate (UDPGA) affinity

  • Account for potential differences in membrane integration and protein stability

What are the functional differences between rat Ugt2a1 and rat Ugt1a6 in olfactory tissues?

Rat Ugt2a1 and Ugt1a6 are co-expressed in olfactory tissues but demonstrate distinct functional properties that complement each other in xenobiotic metabolism:

Substrate Preferences:

  • Ugt2a1: Primarily glucuronidates odorant compounds and steroids

  • Ugt1a6: Mainly involved in the glucuronidation of planar phenols, acetaminophen, and certain carcinogens

Regulatory Mechanisms:

  • Ugt2a1: mRNA expression is upregulated by dexamethasone

  • Ugt1a6: Not modulated by the same inducers that affect Ugt2a1

Age-Dependent Expression:

  • Ugt2a1: Expression in OB increases until 3 months of age, then decreases

  • Ugt1a6: Activity increases significantly in OB for rats older than 3 months

These functional differences suggest complementary roles in olfactory tissue protection, with each enzyme targeting different classes of potentially harmful compounds. Researchers investigating the protective functions of these enzymes should consider their differential regulation and substrate specificity when designing experiments and interpreting results.

How can CRISPR-Cas9 gene editing be utilized to study rat Ugt2a1 function in vivo?

CRISPR-Cas9 gene editing presents powerful opportunities for investigating rat Ugt2a1 function through precise genomic modifications:

Knockout Models:

  • Design of guide RNAs targeting unique regions of exon 1

  • Verification of knockout efficiency by qRT-PCR and Western blotting

  • Phenotypic characterization focusing on olfactory function

  • Toxicological challenge studies to assess protective role

Knockin Approaches:

  • Introduction of reporter tags (GFP, luciferase) for expression monitoring

  • Generation of humanized models replacing rat Ugt2a1 with human UGT2A1

  • Introduction of specific mutations identified in human populations

  • Creation of conditional knockout models for tissue-specific studies

Methodological Considerations:

  • Off-target analysis using whole-genome sequencing

  • Validation of edited lines through multiple generations

  • Complementary in vitro studies with primary cells from edited animals

  • Comprehensive phenotyping beyond targeted olfactory functions

These approaches enable mechanistic studies of Ugt2a1 function that were previously challenging with conventional methods.

What implications does the association between UGT2A1/UGT2A2 and COVID-19-related anosmia have for research on rat Ugt2a1?

The identification of an association between the human UGT2A1/UGT2A2 locus and COVID-19-related loss of smell (anosmia) opens new research directions for rat Ugt2a1 studies:

  • Development of rat models expressing human UGT2A1/UGT2A2 variants associated with differential anosmia risk

  • Investigation of Ugt2a1/Ugt2a2 regulation in response to viral infection in rat olfactory tissues

  • Exploration of the role of glucuronidation in modulating inflammatory responses in olfactory epithelium

  • Examination of Ugt2a1 function in maintaining olfactory receptor neuron homeostasis during stress

  • Comparative studies of olfactory tissue regeneration in models with varying Ugt2a1 expression levels

Methodological approaches should include:

  • Viral challenge studies in rat models with modified Ugt2a1 expression

  • Olfactory function assessment using behavioral and electrophysiological methods

  • Histopathological evaluation of olfactory epithelia following inflammatory challenges

  • Transcriptomic and proteomic analyses of olfactory tissues to identify Ugt2a1-dependent response pathways

This research direction represents a translational opportunity connecting basic enzymatic studies with clinically relevant phenomena.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.