Recombinant Rat Uncharacterized aarF domain-containing protein kinase 4 (Adck4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Coq8b; Adck4; Atypical kinase COQ8B, mitochondrial; AarF domain-containing protein kinase 4; Coenzyme Q protein 8B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-528
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Coq8b
Target Protein Sequence
MWLELGAMLRTTCGPLGRAVRLPCAGALRLRPHWWGPCRDCLAQRVHQDQPGRGLTEDEI RRAREARLRKAPRPQLSDRSRERKVPASRISRLASFGGLAVGLGLGALAEVTKKSLPGGS LQHEGSSPFLTEANAERIVQTLCTVRGAALKIGQMLSIQDNSLISPQLQRVFERVRQSAD FMPRWQMMKVLEEELGKDWQDKVASLEEVPFAAASIGQVHQGVLKDGTEVAVKIQYPGVA ESIQSDVQNLLALLKMSVGLPEGLFAEQSLQTLQQELAWECDYRREAACAQTFKKLLADD PFFRVPAVVEELCTTRVLGMELAGGIPLDQCQGLSQDIRNQICFQLLRLCLRELFEFRFM QTDPNWANFLYDASSHKVTLLDFGASRAFGTEFTDHYIEVVKAAADGDRDRVLQKSQDLK FLTGFETKAFSDAHVEAVMILGEPFAASGSYDFGAGETARRIQGLIPVLLRHRLRPPPEE TYALHRKLAGAFLACARLHAHIACRDLFQDTYHRYWASRQTLPLPAAS
Uniprot No.

Target Background

Function

Atypical kinase involved in coenzyme Q (ubiquinone) biosynthesis. Ubiquinone is a crucial lipid-soluble electron transporter in aerobic cellular respiration. While its precise substrate specificity remains unclear, it lacks protein kinase activity. It likely functions as a small molecule kinase, potentially a lipid kinase phosphorylating a prenyl lipid within the ubiquinone biosynthesis pathway. It is also essential for podocyte migration.

Database Links
Protein Families
Protein kinase superfamily, ADCK protein kinase family
Subcellular Location
Mitochondrion membrane; Single-pass membrane protein. Cytoplasm, cytosol. Cell membrane.
Tissue Specificity
In the kidney, expressed in glomeruli, predominantly in podocyte foot precesses, as well as in proximal tubules and collecting ducts (at protein level).

Q&A

Basic Research Questions

  • What is the functional significance of ADCK4 in rat mitochondria?

ADCK4 plays a crucial role in the biosynthesis of coenzyme Q10 (CoQ10) within rat mitochondria. Similar to human ADCK4, rat ADCK4 is expressed in glomerular podocytes and partially localizes to podocyte mitochondria and foot processes . The protein participates in the electron transport chain by ensuring adequate CoQ10 production, with knockdown studies demonstrating that ADCK4 deficiency results in reduced CoQ10 levels and diminished mitochondrial respiratory enzyme activity . In experimental models, ADCK4 has been shown to interact with other components of the CoQ10 biosynthetic pathway, including COQ6 and COQ7 .

  • What expression systems are most effective for producing recombinant rat ADCK4?

For optimal expression of recombinant rat ADCK4, researchers should consider the following systems:

Expression SystemAdvantagesLimitationsYieldPost-translational Modifications
E. coliCost-effective, rapid, high yieldLimited post-translational modifications, potential inclusion bodiesHighMinimal
Baculovirus/Insect cellsBetter protein folding, some post-translational modificationsMore complex, longer production timeModeratePartial
Mammalian cells (HEK293, CHO)Native-like post-translational modifications, proper foldingExpensive, lower yield, time-consumingLow-ModerateExtensive

When selecting an expression system, consider your experimental requirements. For structural studies where high purity and yield are priorities, E. coli may be sufficient. For functional studies requiring proper folding and post-translational modifications, mammalian expression systems are preferred despite their lower yield .

  • How should recombinant rat ADCK4 be stored to maintain stability and activity?

Optimal storage conditions for recombinant rat ADCK4 are crucial for maintaining its biological activity:

  • For short-term storage (1-2 weeks): Store at 4°C in PBS with 10-20% glycerol

  • For medium-term storage (1-3 months): Store at -20°C in aliquots to avoid freeze-thaw cycles

  • For long-term storage (>3 months): Store at -80°C with cryoprotectants like glycerol or trehalose

Stability studies indicate that repeated freeze-thaw cycles significantly reduce ADCK4 activity. It is recommended to create single-use aliquots before freezing. Additionally, including reducing agents like DTT or β-mercaptoethanol (0.1-1 mM) can help prevent oxidation of critical cysteine residues that may affect protein function .

  • What quality control methods should be used to validate recombinant rat ADCK4?

Multiple validation methods should be employed to confirm identity, purity, and activity:

  • SDS-PAGE and Western blotting: Use validated antibodies specific to rat ADCK4

  • Mass spectrometry: Confirm protein identity and assess post-translational modifications

  • Size-exclusion chromatography: Evaluate protein homogeneity and detect aggregation

  • Functional assays: Measure CoQ10 biosynthesis activity or ATP consumption

  • Circular dichroism: Assess proper protein folding and secondary structure content

For antibody-based detection, several commercial antibodies have been validated for rat ADCK4 detection in Western blot, immunohistochemistry, and immunofluorescence applications .

Advanced Research Questions

  • How does rat ADCK4 differ functionally from human ADCK4?

Comparative analysis between rat and human ADCK4 reveals important distinctions:

FeatureRat ADCK4Human ADCK4Significance
Sequence homologyReference64% amino acid identity Functional domains are conserved
Subcellular localizationPodocyte mitochondria and foot processes Podocyte mitochondria and foot processes Similar localization patterns
Interacting partnersCOQ6, COQ7 predictedCOQ6, COQ7 confirmed Conserved role in CoQ10 biosynthesis
Response to mutationsNot fully characterizedReduced CoQ10 levels, impaired mitochondrial function Human mutations provide insight into rat function

Despite these similarities, species-specific differences may exist in regulatory mechanisms, tissue expression patterns, and responses to pharmacological interventions. Understanding these differences is crucial when translating findings between species for disease modeling .

  • What methodologies are most effective for assessing enzymatic activity of recombinant rat ADCK4?

ADCK4 enzymatic activity can be assessed through multiple complementary approaches:

  • CoQ10 biosynthesis assay: Measure CoQ10 production using HPLC or LC-MS/MS in reconstituted systems containing recombinant ADCK4 and other CoQ biosynthetic enzymes

  • Oxygen consumption rate (OCR): Utilize Seahorse XF analyzers to measure mitochondrial respiration in cells supplemented with recombinant ADCK4

  • ADP-Glo kinase assay: Quantify kinase activity by measuring ATP consumption

  • Radiolabeled precursor incorporation: Track the incorporation of 14C-labeled precursors into CoQ10 in the presence of ADCK4

Research has demonstrated that ADCK4 knockdown in podocytes results in decreased migration, which can be reversed by CoQ10 addition . This migration assay provides an indirect functional readout for ADCK4 activity and its impact on cellular physiology.

  • How do specific mutations in rat ADCK4 affect CoQ10 biosynthesis and mitochondrial function?

Based on human ADCK4 mutation studies, several mechanisms of dysfunction can be anticipated:

Mutation TypeEffect on CoQ10 BiosynthesisMitochondrial ImpactCellular Consequences
Kinase domain mutationsSeverely reduced CoQ10 productionDecreased respiratory enzyme activityImpaired podocyte migration, apoptosis
Membrane-targeting mutationsMislocalization, reduced CoQ10 productionAltered mitochondrial morphologyCompromised energy production
Protein-protein interaction mutationsDisrupted CoQ biosynthetic complexReduced electron transportIncreased ROS production

Studies in patients with ADCK4 mutations show reduced CoQ10 levels and decreased mitochondrial respiratory enzyme activity . Importantly, one patient with a homozygous ADCK4 frameshift mutation showed partial remission following CoQ10 treatment, suggesting that supplementation can bypass the biosynthetic defect .

  • What are the optimal experimental conditions for studying ADCK4's role in mitochondrial function?

For robust investigation of ADCK4's mitochondrial functions, consider the following experimental parameters:

  • Cell models: Primary rat podocytes offer physiological relevance but limited availability; immortalized podocyte cell lines provide reproducibility

  • Mitochondrial isolation: Use differential centrifugation with sucrose gradient purification for intact mitochondria

  • Respiratory conditions: Measure function under both coupled and uncoupled states using substrates specific to different complexes

  • Stress conditions: Evaluate ADCK4 function under oxidative stress (H2O2, paraquat), metabolic stress (glucose deprivation), and hypoxia

  • Visualization techniques: Use super-resolution microscopy with mitotracker and anti-ADCK4 antibodies for co-localization studies

Knockdown experiments in various models have shown that ADCK4 deficiency leads to nephrotic syndrome-associated phenotypes, supporting its critical role in maintaining proper mitochondrial function in podocytes .

  • What interactions between ADCK4 and other proteins in the CoQ10 biosynthetic pathway have been identified?

Research has identified several key protein-protein interactions:

  • COQ6 interaction: ADCK4 directly interacts with COQ6, which has been linked independently to steroid-resistant nephrotic syndrome (SRNS)

  • COQ7 interaction: ADCK4 also interacts with COQ7, another component of the CoQ10 biosynthesis pathway

  • Complex assembly: Evidence suggests ADCK4 may function in assembly or stability of a multi-enzyme CoQ biosynthetic complex

To validate and characterize these interactions, researchers can employ co-immunoprecipitation with specific antibodies, proximity ligation assays, FRET/BRET, or bimolecular fluorescence complementation. The biological significance of these interactions is underscored by the finding that mutations in multiple components of this pathway (including ADCK4, COQ2, COQ6, and PDSS2) all result in nephrotic syndrome with similar pathological features .

  • What are effective genetic manipulation strategies for studying rat ADCK4 function?

Multiple genetic approaches can be employed to investigate ADCK4 function:

ApproachAdvantagesLimitationsValidation Methods
siRNA/shRNA knockdownRapid, cost-effective, tunableIncomplete knockdown, off-target effectsqRT-PCR, Western blot
CRISPR-Cas9 knockoutComplete elimination, stablePotential compensation, difficult rescueSequencing, Western blot
CRISPR-Cas9 knock-inSpecific mutations, physiological expressionComplex generation, low efficiencySequencing, functional assays
AAV-mediated deliveryIn vivo applications, tissue-specificPackaging size limitations, immune responseImmunohistochemistry, functional assays

Previous studies have successfully used knockdown approaches in zebrafish and Drosophila to recapitulate nephrotic syndrome-associated phenotypes . For rat models, adeno-associated virus (AAV) serotype selection is critical for targeting specific tissues of interest .

  • How can researchers effectively study the therapeutic potential of CoQ10 supplementation in ADCK4-deficient models?

Based on clinical observations of partial remission in a patient with ADCK4 mutation following CoQ10 treatment , researchers should consider:

  • Dose-response relationship: Test multiple CoQ10 concentrations (typically 1-100 μM for in vitro studies)

  • Timing of intervention: Evaluate preventive versus therapeutic administration

  • Formulation selection: Compare water-soluble versus lipid-soluble CoQ10 preparations

  • Delivery methods: For in vivo studies, compare oral, intraperitoneal, or targeted delivery

  • Outcome measures: Monitor mitochondrial function, podocyte migration, proteinuria, and kidney histology

  • Combinatorial approaches: Test CoQ10 with other mitochondrial supporting compounds

The therapeutic efficacy of CoQ10 supplementation in ADCK4-deficient models suggests potential clinical applications for patients with steroid-resistant nephrotic syndrome due to mutations in ADCK4 or other genes involved in CoQ10 biosynthesis .

  • What biosafety considerations apply when working with recombinant rat ADCK4?

When conducting research with recombinant rat ADCK4:

  • Risk assessment: ADCK4 is generally categorized as Risk Group 1 (RG1), as it is not associated with disease in healthy adults

  • Containment level: Biosafety Level 1 (BSL-1) practices are typically sufficient

  • Regulatory compliance: Follow institutional biosafety committee (IBC) guidelines for recombinant DNA work

  • Documentation requirements: Register experiments involving recombinant ADCK4 with your institutional IBC if required

  • Vector considerations: Special consideration may be needed for viral vectors used for ADCK4 expression or delivery

Institutions receiving NIH funding must comply with NIH Guidelines for Research Involving Recombinant or Synthetic Nucleic Acid Molecules, regardless of the funding source for the specific project .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.