Recombinant Rat Uncharacterized protein C17orf62 homolog

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Cybc1; Eros; Cytochrome b-245 chaperone 1; Essential for reactive oxygen species protein; Eros
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-187
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Protein Sequence
MYMQVETRTSTRLHLKRAPGIRSWSLLVGILSTGLAAAYYSGDSLGWKLFYVTGCLFVAV QNLEDWEEAIFNKSTGKVILKTFSLYKKLLTLLRAGHDQVVVLLKDIQDVNVEEEKVRYF GKGYMVVLRFATGFSHPLTQSAVMGRRSDVEAIAKLITSFLELHRLESPSERSQSSDSEP DGPGGQS
Uniprot No.

Target Background

Function
This protein functions as a chaperone, crucial for the stable expression of the CYBA and CYBB subunits within the cytochrome b-245 heterodimer. It regulates the phagocyte respiratory burst and is essential for innate immunity.
Database Links

KEGG: rno:619574

UniGene: Rn.162222

Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

What is the known structural information about Recombinant Rat Uncharacterized Protein C17orf62 Homolog?

The recombinant rat uncharacterized protein C17orf62 homolog comprises 187 amino acids in its full-length form (positions 1-187) . When expressed recombinantly in E. coli, it is typically tagged with a histidine tag to facilitate purification . While detailed three-dimensional structural information remains limited, the protein shares homology with C17orf62 proteins from other mammalian species, including a mouse homolog that also spans 187 amino acids . Structural prediction methods based on homology modeling may provide preliminary insights, though experimental validation through techniques like X-ray crystallography or cryo-EM would be required for definitive structural characterization.

Which species variants of C17orf62 homolog are available for comparative research?

Currently, recombinant versions of C17orf62 homolog are available for at least two rodent species: rat (Rattus norvegicus) and mouse (Mus musculus) . Both recombinant proteins are produced in E. coli expression systems with histidine tags and represent the full-length protein (amino acids 1-187) . This availability enables comparative studies between these closely related species, potentially revealing conserved features that might indicate functional importance. Researchers interested in evolutionary conservation might consider expanding analyses to include homologs from other mammals, though the commercial availability of such variants would need to be verified.

What cellular localization patterns have been observed for C17orf62 homolog?

Cellular fractionation experiments followed by western blotting and LC-MS/MS protein identification have provided some insights into the subcellular localization of C17orf62 homolog. In one study, the protein was detected in cellular fractions that did not contain calreticulin (CALR), an ER-resident protein marker . Some positive fractions contained lysosome-associated membrane protein 1 (LAMP-1) along with Hsp47, a protein known to bind triple helical collagen . This suggests potential association with non-ER membrane compartments, possibly including lysosome-related structures. The identification of C17orf62 in these specific cellular fractions indicates it may play a role in membrane-associated processes, potentially related to protein trafficking or processing.

What are the recommended protocols for optimizing expression of Recombinant Rat C17orf62 Homolog in E. coli systems?

For optimal expression of recombinant rat C17orf62 homolog in E. coli, researchers should consider several key factors. First, codon optimization for E. coli usage can significantly improve expression levels, particularly for mammalian proteins. The expression vector should include the full coding sequence (amino acids 1-187) with an N-terminal or C-terminal histidine tag for purification . Induction conditions require careful optimization, typically testing IPTG concentrations between 0.1-1.0 mM at different temperatures (16-37°C) and induction times (3-16 hours). Lower temperatures (16-25°C) often improve solubility of mammalian proteins. Following expression, cell lysis under native conditions using appropriate buffers (typically containing 20-50 mM Tris-HCl pH 7.5-8.0, 100-300 mM NaCl, and protease inhibitors) allows for protein extraction. Purification via nickel affinity chromatography, leveraging the histidine tag, followed by size exclusion chromatography can yield high-purity protein suitable for downstream applications.

How can researchers verify the identity and integrity of purified C17orf62 homolog?

Verification of recombinant C17orf62 homolog identity and integrity requires multiple complementary approaches. Initially, SDS-PAGE analysis should confirm the expected molecular weight of approximately 21 kDa (accounting for the 187 amino acids plus the histidine tag) . Western blotting using anti-His antibodies can verify the presence of the tag. For definitive identification, mass spectrometry analysis, particularly LC-MS/MS peptide mapping against the expected sequence, provides conclusive evidence of protein identity . Circular dichroism spectroscopy can assess secondary structure integrity, while dynamic light scattering evaluates homogeneity and potential aggregation. Importantly, researchers should verify protein stability through thermostability assays and storage stability tests at different temperatures (-80°C, -20°C, 4°C) with various buffer conditions to determine optimal handling procedures. These combined approaches ensure both the identity and the structural integrity of the purified protein.

What cellular fractionation methods are most effective for studying endogenous C17orf62 homolog localization?

Based on published research, differential ultracentrifugation combined with density gradient separation has proven effective for studying C17orf62 homolog localization . Researchers should begin with gentle cell lysis using buffers containing protease inhibitors, followed by sequential centrifugation steps to separate major cellular components (nuclei, mitochondria, lysosomes, microsomes, and cytosol). Since C17orf62 has been detected in fractions containing LAMP-1 (lysosome marker) but lacking CALR (ER marker), particular attention should be paid to membrane fraction separation . Sucrose or iodixanol gradient centrifugation (20-50%) can further resolve membrane compartments. Each fraction should be analyzed by western blotting with antibodies against C17orf62 alongside markers for various organelles (CALR for ER, LAMP-1 for lysosomes, etc.) . For more detailed characterization, immunofluorescence microscopy using specific antibodies against C17orf62 and co-staining with organelle markers can complement biochemical fractionation. LC-MS/MS analysis of positive fractions provides additional confirmation and may reveal co-localizing proteins .

What protein interaction networks involve C17orf62 homolog, and how might these inform its function?

Proteomic analyses have identified C17orf62 in interaction networks related to membrane proteins and cellular trafficking machinery. In a neuroglobin (NGB) interactome study, C17orf62 was detected with a difference value of 3.5 and a CRAPome score of 0/716, suggesting it is not a common contaminant in affinity purification-mass spectrometry experiments . This study placed C17orf62 in a network involving proteins associated with organelle functions, metabolic processes, hypoxia response, and autophagy regulation . While direct binary interactions with C17orf62 were not specifically detailed, its presence in fractions containing LAMP-1 and Hsp47 (a collagen-binding protein) suggests potential associations with lysosomal pathways and/or collagen processing . To further elucidate the interaction network, researchers could employ techniques such as proximity labeling (BioID or APEX), cross-linking mass spectrometry, or yeast two-hybrid screening using C17orf62 as bait. Validation of identified interactions through co-immunoprecipitation and functional studies would provide insights into the biological relevance of these associations.

How might C17orf62 homolog contribute to collagen processing based on current evidence?

The potential role of C17orf62 homolog in collagen processing emerges from cellular fractionation studies where it was found in fractions containing Hsp47, a known collagen-binding protein that assists in triple helical collagen formation . This localization pattern, combined with its detection in non-ER, possibly lysosome-related compartments, suggests C17orf62 might function in post-ER collagen trafficking or processing. Collagen fibril formation at the plasma membrane, as mentioned in the bioRxiv paper context, requires multiple processing steps after ER exit . C17orf62 could potentially function as a chaperone, similar to Hsp47, or as a component of specialized vesicular compartments involved in collagen secretion and assembly. To investigate this hypothesis, researchers could examine the effects of C17orf62 knockdown or overexpression on collagen secretion rates, fibril formation, and extracellular matrix organization. Co-localization studies with collagen and markers of the secretory pathway would help map the precise steps where C17orf62 might function. Additionally, in vitro binding assays between purified recombinant C17orf62 and various collagen types could reveal direct interactions and potential specificity.

What is the significance of C17orf62 having a CRAPome score of 0/716 in proteomic studies?

The CRAPome (Contaminant Repository for Affinity Purification) score of 0/716 for C17orf62 is highly significant in interpreting proteomic interaction data . This score indicates that C17orf62 was not detected as a contaminant in any of the 716 control experiments compiled in the CRAPome database, which catalogs proteins commonly found in affinity purification-mass spectrometry experiments regardless of the bait protein used. A score of 0/716 strongly suggests that when C17orf62 is detected in such experiments (as in the neuroglobin interactome study), it represents a genuine interaction rather than a non-specific contaminant . This high confidence metric elevates the significance of C17orf62's identification in protein interaction networks and suggests it may have specific biological interactions rather than promiscuous binding tendencies. For researchers studying C17orf62, this low contaminant profile means that interactions identified through pull-down experiments are more likely to be biologically relevant and worthy of further investigation. When designing interaction proteomics experiments with C17orf62 as bait, this property suggests that stringent washing conditions can be employed without significant risk of losing true interactors.

How should researchers interpret the -Log(P-value) of 1.752 for C17orf62 in proteomics datasets?

The -Log(P-value) of 1.752 for C17orf62 in the neuroglobin interactome study translates to a P-value of approximately 0.018 (10^-1.752) . In proteomics, this value represents the statistical significance of the protein's enrichment in the experimental condition compared to controls. A P-value of 0.018 is below the commonly used threshold of 0.05, indicating the association is statistically significant, though not among the most highly significant proteins in the dataset (which show -Log(P-values) above 3 or 4) . When interpreting this value, researchers should consider it alongside other metrics like fold change (reported as "Difference" of 3.5) and the CRAPome score (0/716) . The moderate statistical significance combined with a good fold change and excellent CRAPome score suggests C17orf62 is likely a true interactor, albeit not among the strongest or most abundant in the network. Researchers should validate this interaction using orthogonal methods such as co-immunoprecipitation or proximity labeling. Additionally, this level of significance might indicate a transient or context-dependent interaction that could be stabilized or enhanced under specific cellular conditions.

What experimental controls are essential when studying potential roles of C17orf62 in autophagy regulation?

Given C17orf62's appearance in a network associated with autophagy regulation , proper controls are critical when investigating its potential roles in this process. Essential controls should include:

  • Genetic controls: Compare wild-type cells with C17orf62 knockout/knockdown and rescue models. CRISPR/Cas9-mediated gene editing can generate complete knockouts, while siRNA or shRNA approaches provide transient depletion . Rescue experiments reintroducing wild-type or mutant versions confirm specificity.

  • Pharmacological controls: Pair C17orf62 manipulations with standard autophagy modulators (rapamycin for induction, bafilomycin A1 or chloroquine for flux inhibition) to determine where in the pathway C17orf62 functions.

  • Nutritional controls: Test autophagy responses under fed conditions, starvation, and recovery to assess if C17orf62 functions are baseline or stress-responsive.

  • Marker controls: Monitor established autophagy markers (LC3-I to LC3-II conversion, p62/SQSTM1 levels, ULK1 phosphorylation status) alongside C17orf62 manipulations.

  • Imaging controls: For fluorescence microscopy, include proper antibody controls and colocalization with autophagosome markers at different maturation stages.

  • Interaction controls: When performing interaction studies with autophagy machinery components (potentially RPTOR/mTORC1 pathway members ), include both positive interactors and negative control proteins.

These comprehensive controls will help distinguish direct effects of C17orf62 on autophagy from indirect consequences or experimental artifacts.

How can researchers differentiate between direct and indirect effects when manipulating C17orf62 expression in cellular systems?

Differentiating between direct and indirect effects of C17orf62 manipulation requires a multi-faceted approach:

  • Temporal analysis: Monitor changes in cellular processes immediately following acute C17orf62 depletion or induction (using inducible expression systems or degradation tags). Direct effects typically manifest more rapidly than downstream consequences.

  • Dose-dependency assessment: Establish a correlation between C17orf62 expression levels and the magnitude of phenotypic changes. Direct effects often show clear dose-response relationships.

  • Structure-function studies: Generate truncation or point mutants of C17orf62 to identify specific domains or residues required for particular functions. This approach maps functional regions and can separate different activities.

  • Proximity-based approaches: Employ BioID, APEX, or photoactivatable crosslinkers fused to C17orf62 to identify proteins in its immediate vicinity under native conditions.

  • In vitro reconstitution: Test whether purified recombinant C17orf62 directly affects biochemical processes of interest in cell-free systems, eliminating cellular complexity.

  • Reversibility tests: Demonstrate that reintroduction of C17orf62 in knockout models rescues the phenotype with kinetics consistent with direct action.

  • Comparative analysis: Contrast the effects of C17orf62 manipulation with those of established regulators of the process under investigation, paying attention to similarities and differences in phenotypic signatures.

This systematic approach helps establish causal relationships between C17orf62 and observed cellular phenotypes, distinguishing its direct molecular functions from broader adaptive responses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.