Recombinant Rat Uncharacterized protein C1orf115 homolog

What is the Recombinant Rat Uncharacterized protein C1orf115 homolog?

Recombinant Rat Uncharacterized protein C1orf115 homolog is a full-length rat protein comprising 140 amino acids that represents the rat equivalent of the human C1orf115 (Chromosome 1 Open Reading Frame 115) protein . The protein is currently classified as "uncharacterized" because its specific biological functions, cellular pathways, and physiological roles have not been thoroughly determined. The recombinant form is typically produced with an N-terminal histidine tag to facilitate purification and detection in experimental settings . As a recombinant protein expressed in E. coli, it provides researchers with a reliable source of the protein for various biochemical and functional studies without the need to isolate it from rat tissue samples.

What is the amino acid sequence and structure of the Rat C1orf115 homolog?

The complete amino acid sequence of the Rat C1orf115 homolog consists of 140 amino acids as follows:

MTVGARLRSKASSLVGRGPLGRLRRAGDEETDAIVEHLEGEDEDPESQDCEREEDGRRAG TPSARRVHLAALPERYDSLEEPAPGDKPKKRYRRKLKKYGKNVGKAISKGCRYIVIGLQG FAAAYSAPFGVATSVVSFVR

The protein contains multiple charged residues (particularly arginine and lysine), suggesting potential roles in nucleic acid binding or protein-protein interactions. The structure has not been experimentally determined through crystallography or NMR studies based on the available information. Sequence analysis reveals the presence of several potential regulatory motifs, including possible phosphorylation sites and nuclear localization signals, though these would require experimental validation. Researchers often employ bioinformatic tools to predict secondary and tertiary structures based on this sequence to guide hypothesis development about potential functions.

How should the recombinant protein be handled and stored for optimal stability?

For optimal stability of the Recombinant Rat C1orf115 homolog protein, researchers should follow several key protocols:

The protein is supplied as a lyophilized powder, which should be stored at -20°C to -80°C upon receipt . Before opening, it is recommended to briefly centrifuge the vial to bring the contents to the bottom . For reconstitution, the protein should be dissolved in deionized sterile water to a concentration of 0.1-1.0 mg/mL . After reconstitution, it is highly recommended to add glycerol to a final concentration of 5-50% (with 50% being the default recommendation) to prevent freeze-thaw damage .

Long-term storage should be in aliquots at -20°C to -80°C to avoid repeated freeze-thaw cycles, which significantly degrade protein quality . For short-term use, working aliquots can be stored at 4°C for up to one week . The protein is maintained in a Tris/PBS-based buffer with 6% trehalose at pH 8.0, which helps preserve its stability during freeze-drying and reconstitution processes .

What genome editing approaches are recommended for studying C1orf115 function in rat models?

Several genome editing approaches can be effectively employed to study C1orf115 function in rat models, with CRISPR-Cas9 systems offering the most efficient and versatile options:

The classical SpCas9 system with NGG PAM requirements has been successfully used in rats and would be suitable for targeting C1orf115 . For more precise editing with reduced off-target effects, researchers might consider using enhanced versions such as SpCas9 nickase, which has been validated in mice though not yet documented in rats . When designing knockout experiments, researchers should carefully select target sites that ensure complete functional disruption, preferably in early exons or essential functional domains.

For more complex genetic manipulations, AsCpf1 (Cas12a) or LbCpf1 (Cas12a) systems that create staggered cuts with TTTV PAM requirements have been successfully applied in rats and could offer advantages for knock-in strategies . These systems would be particularly useful for introducing reporter genes or creating conditional alleles of C1orf115. The table below summarizes key CRISPR systems applicable to C1orf115 editing in rats:

How can researchers address the challenges of studying an "uncharacterized" protein like C1orf115?

Studying uncharacterized proteins like C1orf115 presents unique challenges that require systematic investigative approaches:

First, researchers should begin with comprehensive bioinformatic analysis, employing tools for sequence homology searches, domain prediction, and phylogenetic analysis to identify potential conserved functions across species. This comparative genomics approach can provide initial hypotheses about function based on evolutionary relationships with characterized proteins.

For experimental characterization, a multi-omics strategy is recommended. Proteomics approaches such as immunoprecipitation coupled with mass spectrometry can identify binding partners, suggesting potential pathways in which C1orf115 participates . Transcriptomics analysis following C1orf115 knockout or overexpression can reveal affected gene networks and potential regulatory roles. Metabolomics analysis may identify biochemical pathways impacted by C1orf115 manipulation.

Cellular localization studies using fluorescently tagged C1orf115 can provide insights into its subcellular distribution and potential function. Developmental expression profiling across tissues and time points can indicate when and where the protein may play critical roles. Finally, phenotypic characterization of knockout models should be comprehensive, examining multiple physiological systems and potential disease-relevant phenotypes, particularly since rat models often better reproduce clinical features observed in humans compared to mouse models .

What are the comparative advantages of studying C1orf115 in rat models versus mouse models?

Rat models offer several distinct advantages over mouse models for studying proteins like C1orf115, particularly when translational relevance to human biology is important:

The rat genome (2.75 Gb) is larger than the mouse genome (2.6 Gb) and closer in size to the human genome (2.9 Gb), potentially preserving regulatory elements that might be lost in mice . Rats show enrichment of genes involved in immunity, metabolic detoxification, and chemosensation, as well as conservation of many genes involved in human diseases, making them potentially more suitable for studies related to these systems .

Physiologically, rats often better reproduce clinical features observed in humans who carry gene variants compared to mice, improving translational relevance . This is particularly important for studying proteins like C1orf115 whose functions are unknown but may relate to complex physiological processes. The increased size of rats also facilitates certain experimental procedures, including serial sampling, surgical manipulations, and in vivo imaging with higher resolution.

For behavioral and neurological studies, rats generally demonstrate more sophisticated behavioral traits, making them preferred models for neurobehavioral studies if C1orf115 is found to have neurological functions . In disease modeling, rats have proven particularly valuable for autoimmune disease research, with several genetic loci identified that regulate rat myelin oligodendrocyte glycoprotein-induced experimental autoimmune encephalomyelitis (MOG-EAE) . If C1orf115 is found to have immunological functions, rat models may provide superior disease relevance.

What experimental protocols optimize working with Recombinant Rat C1orf115?

To optimize experimental work with Recombinant Rat C1orf115, researchers should implement several key methodological considerations:

For protein quality assessment, it is essential to verify protein purity using SDS-PAGE before experiments, with the commercial preparation reported to have greater than 90% purity . Western blotting using anti-His tag antibodies can confirm the presence of the full-length protein. Before functional assays, researchers should perform activity tests appropriate to the hypothesized protein function.

For reconstitution and handling, the protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with the addition of glycerol (5-50%, with 50% being standard) to prevent freeze-thaw damage . Since the protein is His-tagged, immobilized metal affinity chromatography (IMAC) can be employed for further purification if needed.

For experimental applications, buffer compatibility should be tested as buffer components may affect protein activity or stability. If transferring to a different buffer system, dialysis or desalting columns are recommended rather than dilution to avoid potential interference from the original Tris/PBS-based storage buffer . For binding assays, researchers should consider the potential effects of the His tag on protein-protein or protein-ligand interactions; in some cases, tag removal using appropriate proteases may be necessary.

How can functional assays be designed to characterize the biological role of C1orf115?

Designing effective functional assays for an uncharacterized protein like C1orf115 requires a systematic approach that combines prediction-based hypotheses with broad-spectrum activity testing:

Biochemical characterization should begin with testing for enzymatic activities based on sequence-predicted functional domains. This may include assays for common enzymatic functions such as kinase, phosphatase, protease, or nuclease activities. Binding assays using techniques such as surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) can identify potential ligands, which might include nucleic acids, metabolites, or other proteins based on sequence features.

For cellular function analysis, overexpression and knockdown/knockout studies in relevant cell lines can reveal phenotypic changes related to proliferation, differentiation, migration, or response to stressors. Subcellular localization studies using fluorescently tagged C1orf115 can provide clues about its function based on compartmentalization. CRISPR-Cas9 genome editing in rats provides a powerful approach for in vivo functional characterization , with the ability to create precise genetic modifications for studying C1orf115 function.

Multi-omics approaches integrating transcriptomics, proteomics, and metabolomics analyses following C1orf115 manipulation can identify affected pathways and networks. Comparative studies between rat and human systems can help validate the translational relevance of findings, taking advantage of the rat's closer physiological similarity to humans in many systems compared to mice .

What considerations should be made when developing antibodies against C1orf115?

Developing effective antibodies against uncharacterized proteins like C1orf115 presents unique challenges that require careful planning:

For epitope selection, researchers should perform in silico analysis of the C1orf115 sequence to identify regions with high antigenicity, surface accessibility, and minimal sequence conservation with other proteins to ensure specificity. Hydrophilic regions and predicted surface loops often make good epitope candidates. Multiple epitopes should be targeted to increase the chances of generating functional antibodies.

When producing antibodies, researchers may choose between monoclonal and polyclonal approaches. Monoclonal antibodies offer high specificity but are typically more resource-intensive to develop. Polyclonal antibodies provide broader epitope recognition but may have higher batch-to-batch variability. For either approach, the recombinant His-tagged C1orf115 protein provides an excellent immunogen .

For validation, comprehensive testing is essential. Cross-reactivity testing should include closely related proteins and samples from C1orf115 knockout models as negative controls. Applications testing should validate the antibody in multiple techniques (Western blot, immunoprecipitation, immunohistochemistry, etc.) as performance often varies across applications. Epitope accessibility testing should account for potential post-translational modifications or protein-protein interactions that might mask epitopes in native conditions.

How might C1orf115 function in disease models and translational research?

The uncharacterized nature of C1orf115 presents both challenges and opportunities for disease model research:

Given the lack of established function, a systematic phenotyping approach in C1orf115 knockout rat models would be valuable. This should include comprehensive assessment of multiple physiological systems, including metabolism, immunity, neurobehavior, and cardiovascular function. Rats often demonstrate more sophisticated traits in these areas compared to mice, potentially revealing phenotypes that might be missed in mouse models .

For potential autoimmune disease connections, the established protocols for myelin oligodendrocyte glycoprotein-induced experimental autoimmune encephalomyelitis (MOG-EAE) in rats could be applied to C1orf115 modified animals to assess any immune regulatory functions . The rat MOG-EAE model closely mimics multiple sclerosis histopathologically, with prominent demyelination and axonal damage, and follows a chronic relapsing disease course that better mirrors the human condition .

Genetic association studies examining C1orf115 variants in human patient cohorts could provide valuable leads for targeted investigation in rat models. If human variants are identified, corresponding mutations could be introduced into rats using CRISPR-Cas9 genome editing approaches . The resulting models would allow for detailed mechanistic studies and potential therapeutic testing with improved translational relevance.

What genomic approaches can be used to study C1orf115 regulatory networks?

Understanding the regulatory networks involving C1orf115 requires sophisticated genomic approaches:

Chromatin immunoprecipitation sequencing (ChIP-seq) can be employed if C1orf115 is suspected to interact with DNA, either directly or as part of a complex. This approach would identify genome-wide binding sites and potential target genes. For proteins without direct DNA interaction, techniques like ChIP-seq against transcription factors following C1orf115 manipulation can reveal affected regulatory pathways.

RNA sequencing (RNA-seq) of tissues or cells from wild-type versus C1orf115 knockout rats can identify differentially expressed genes, suggesting pathways influenced by C1orf115. This should be performed across multiple tissues and developmental stages to capture context-specific effects. ATAC-seq (Assay for Transposase-Accessible Chromatin with sequencing) can reveal changes in chromatin accessibility resulting from C1orf115 manipulation, providing insights into its potential role in epigenetic regulation.

For identifying interaction networks, proximity labeling techniques such as BioID or APEX combined with mass spectrometry can map proteins that physically associate with C1orf115 in living cells. These approaches are particularly valuable for proteins with dynamic or weak interactions that might be missed by traditional co-immunoprecipitation methods. The resulting networks can be integrated with transcriptomic data to build comprehensive models of C1orf115's functional context.