Recombinant Rat Uncharacterized protein C1orf43 homolog

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Protein C1orf43 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-235
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Protein Sequence
MASSSNWLSGVNVVLVMAYGSLVFVLLFIFVKRQIMRFAMKSRRGPHVPVGHNAPKDLKE EIDIRLSRVQDIKYEPQLLADDDTRLLQLETQGSQKIPFHAEGRHPCSLMGKNFRSYLLD LRNTSTPFKGVRKALIDTLLDGYETARYGTGVFGQSEYLRYQEALSELATVVKARIGSSQ RQHQSAAKDLTQSPEMSPTTIQVTYLPSSQKSKRPKHFLELKSFKDNYNTLESTL
Uniprot No.

Target Background

Function

A general regulator of phagocytosis; essential for the uptake of Gram-negative bacteria by macrophages.

Database Links

KEGG: rno:361985

UniGene: Rn.107173

Subcellular Location
Membrane; Single-pass membrane protein. Golgi apparatus. Mitochondrion.

Q&A

What is known about the potential functions of C1orf43 homolog proteins?

Despite being labeled as "uncharacterized," emerging research suggests several potential functions:

  • Membrane localization: The protein sequence contains hydrophobic regions suggesting transmembrane domains, particularly in the N-terminal region

  • Potential involvement in cellular signaling: Contains sequence motifs consistent with signaling proteins

  • Evolutionary conservation: High conservation across species suggests fundamental cellular function

  • Potential roles in protein trafficking or membrane organization based on structural predictions

What are the optimal storage conditions for maintaining activity of Recombinant Rat C1orf43 homolog?

For optimal preservation of protein activity, follow these evidence-based storage protocols:

Storage PeriodRecommended ConditionsNotes
Short-term (≤1 week)4°C in working aliquotsMinimizes freeze-thaw cycles
Medium-term-20°C in small aliquotsWith 50% glycerol recommended
Long-term-80°CAliquot before freezing

Critical handling guidelines:

  • Always centrifuge vials briefly before opening to collect protein at the bottom

  • Reconstitute lyophilized protein in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 50% for cryoprotection

  • Strictly avoid repeated freeze-thaw cycles as they significantly reduce activity

  • When working with the protein, maintain cold chain whenever possible

What reconstitution protocols yield optimal protein activity for experimental use?

A standardized reconstitution protocol based on experimental validation includes:

  • Allow the protein vial to equilibrate to room temperature for 15 minutes

  • Briefly centrifuge at 10,000 × g for 30 seconds to collect protein at the bottom

  • For lyophilized protein:

    • Add sterile deionized water to achieve concentration of 0.1-1.0 mg/mL

    • Gently rotate or invert the vial to ensure complete dissolution

    • DO NOT vortex or vigorously shake as this can cause protein denaturation

  • Add glycerol to 50% final concentration for stability

  • Divide into small working aliquots (10-20 μL) to minimize freeze-thaw cycles

  • Use Tris/PBS-based buffer with 6% Trehalose at pH 8.0 if dilution is required

What experimental systems are appropriate for studying the function of Recombinant Rat C1orf43 homolog?

Several experimental systems have proven effective for functional characterization:

  • Cell Culture Models:

    • Rat neuronal cell lines (particularly for brain-expressed proteins)

    • Kidney cell models (podocytes) where expression has been detected

    • Transfection of tagged constructs for localization and interactome studies

  • Biochemical Approaches:

    • Pull-down assays to identify binding partners

    • Subcellular fractionation to determine localization

    • Structural studies (X-ray crystallography or cryo-EM) for protein structure

  • Functional Genomics:

    • CRISPR-Cas9 knockouts to observe phenotypic effects

    • RNAi for transient knockdown studies

    • Overexpression studies to observe gain-of-function effects

  • Proteomic Analysis:

    • Mass spectrometry to identify post-translational modifications

    • Protein-protein interaction mapping through proximity labeling

    • Quantitative proteomics to identify changes in cellular pathways upon manipulation

How can researchers experimentally determine binding partners of C1orf43 homolog?

A systematic approach to identifying binding partners includes:

  • Affinity Purification Coupled with Mass Spectrometry:

    • Express His-tagged C1orf43 homolog in appropriate cell lines

    • Perform pull-down experiments using Ni-NTA or similar resin

    • Process samples for mass spectrometry

    • Analyze results using appropriate bioinformatics tools to filter out common contaminants

  • Yeast Two-Hybrid Screening:

    • Construct bait plasmids containing C1orf43 homolog

    • Screen against rat cDNA libraries

    • Validate positive interactions through secondary assays

  • Proximity Labeling Approaches:

    • Generate BioID or APEX2 fusion constructs

    • Express in relevant cell types

    • Identify labeled proteins through streptavidin pull-down and mass spectrometry

  • Co-Immunoprecipitation with Specific Antibodies:

    • Use anti-His tag antibodies for the recombinant protein

    • Validate interactions using reciprocal co-immunoprecipitation

    • Perform experiments under different cellular conditions to identify context-dependent interactions

How does Rat C1orf43 homolog compare structurally and functionally to its human counterpart?

Comparison of rat and human C1orf43 proteins reveals important insights into evolutionary conservation:

FeatureRat C1orf43 HomologHuman C1orf43Notes
Protein Length235 amino acids253 amino acidsRat protein is slightly shorter
Sequence IdentityReference~85-90%High conservation indicates functional importance
Predicted DomainsTransmembrane region in N-terminusSimilar domain architectureStructural conservation
Expression PatternBrain, kidneyWidespread, high in lung, spleen, colonSome tissue-specific differences
Known InteractionsLimited characterizationBetter characterizedHuman interactome data more extensive

The high degree of sequence conservation between species suggests fundamental cellular functions that have been maintained through evolution. Functional studies in rat models are likely to provide insights transferable to human biology, though species-specific differences should be considered when translating findings .

What techniques are most effective for identifying and analyzing homologs of C1orf43 across different species?

A multifaceted approach to homology analysis includes:

  • Sequence-Based Methods:

    • BLAST searches against genomic and protein databases

    • Use of specialized homology databases like HomoloGene

    • Multiple sequence alignment using MUSCLE, CLUSTAL, or T-Coffee

    • Phylogenetic analysis to establish evolutionary relationships

  • Structure-Based Methods:

    • Protein structure prediction using tools like AlphaFold

    • Structural alignment to identify conservation despite sequence divergence

    • Domain architecture analysis to identify functional units

  • Functional Genomics Approaches:

    • Cross-species complementation studies

    • Analysis of conserved genetic interactions

    • Comparison of expression patterns across species

Step-by-step methodology:

  • Start with a protein BLAST search using the rat C1orf43 homolog sequence

  • Follow links to HomoloGene database for pre-computed homologs

  • For detailed analysis, obtain protein sequences from various species and perform multiple sequence alignment

  • Use phylogenetic tree construction to visualize evolutionary relationships

  • Validate functional homology through experimental approaches

What strategies can researchers employ to elucidate the function of this uncharacterized protein?

A comprehensive functional characterization strategy includes:

  • Integrative Omics Approach:

    • Transcriptomics: RNA-seq after knockdown/overexpression to identify affected pathways

    • Proteomics: Quantitative proteomics to identify changes in protein abundance

    • Metabolomics: Analysis of metabolic changes upon protein manipulation

    • Interactomics: Identification of protein-protein interaction networks

  • Cellular Localization and Trafficking:

    • Fluorescently tagged constructs for live-cell imaging

    • Colocalization with organelle markers

    • FRAP (Fluorescence Recovery After Photobleaching) to study protein dynamics

    • Super-resolution microscopy for precise localization

  • Structure-Function Analysis:

    • Site-directed mutagenesis of key residues

    • Truncation constructs to identify functional domains

    • Expression of protein fragments to identify minimal functional units

  • Physiological Context:

    • Tissue-specific expression analysis

    • Developmental expression profiling

    • Response to various cellular stresses and stimuli

  • In Vivo Models:

    • Generation of knockout rat models using CRISPR-Cas9

    • Phenotypic characterization across multiple systems

    • Rescue experiments to confirm specificity of effects

What are the challenges in working with uncharacterized proteins, and how can they be addressed methodologically?

Working with uncharacterized proteins presents several distinct challenges:

ChallengeMethodological Solution
Lack of validated antibodiesGenerate custom antibodies against peptide sequences with high predicted antigenicity or use epitope tags in recombinant constructs
Unknown post-translational modificationsPerform comprehensive mass spectrometry analysis with enrichment for common modifications
Limited information on stabilityConduct systematic buffer optimization studies, thermal shift assays to identify stabilizing conditions
Unknown binding partnersUse unbiased screening approaches (Y2H, BioID, AP-MS) followed by targeted validation
Difficulty in phenotypic readoutsApply multiple functional assays in parallel, utilize high-content screening approaches
Potential redundancy with related proteinsEmploy combinatorial knockdown/knockout approaches targeting multiple family members

Strategic approach:

  • Begin with bioinformatic prediction of domains, motifs, and potential functions

  • Plan experiments to test multiple hypotheses in parallel rather than sequentially

  • Establish collaborations with researchers studying related proteins or processes

  • Prioritize the development of robust assays to measure protein activity

  • Consider both gain- and loss-of-function approaches to triangulate function

How can researchers troubleshoot low protein activity or stability issues with Recombinant Rat C1orf43 homolog?

When encountering activity or stability issues, implement this systematic troubleshooting approach:

  • Buffer Optimization:

    • Test multiple buffer systems (Tris, HEPES, phosphate) at various pH values (6.5-8.5)

    • Evaluate different salt concentrations (50-500 mM NaCl)

    • Screen additives (glycerol, trehalose, arginine, glutamic acid)

    • Use thermal shift assays to quantitatively assess stability improvements

  • Expression and Purification Assessment:

    • Verify protein integrity by SDS-PAGE and Western blotting

    • Consider alternative expression systems (mammalian, insect cells)

    • Optimize purification conditions to minimize exposure to harsh conditions

    • Implement on-column refolding if inclusion bodies are an issue

  • Activity Assay Refinement:

    • Develop multiple orthogonal assays for functional activity

    • Include positive controls with known activity

    • Test protein activity immediately after purification

    • Consider that cofactors or binding partners may be required for activity

  • Storage Optimization:

    • Compare fresh vs. stored protein activity

    • Test cryoprotectants beyond glycerol (sucrose, arginine, BSA)

    • Evaluate lyophilization with appropriate excipients as an alternative

    • Consider chemical stabilizers specific to the protein class

What are the recommended approaches for validating experimental results obtained with this uncharacterized protein?

Robust validation strategies include:

  • Multiple Detection Methods:

    • Combine antibody-based detection with mass spectrometry

    • Use epitope tags at both N- and C-termini to confirm full-length protein

    • Apply label-free techniques alongside labeled approaches

  • Orthogonal Functional Assays:

    • Implement at least three independent assay types to measure activity/function

    • Include structure-function studies with mutant variants

    • Perform dose-response experiments to establish quantitative relationships

  • Genetic Validation:

    • Use CRISPR-Cas9 to generate knockout cell lines as negative controls

    • Perform rescue experiments with the recombinant protein

    • Use siRNA/shRNA for orthogonal knockdown validation

  • Cross-Species Confirmation:

    • Test if human or mouse orthologs produce similar results

    • Use evolutionary conservation as a predictor of functional importance

    • Apply comparative genomics to identify conserved interaction networks

  • Reproducibility Measures:

    • Perform experiments with multiple protein batches

    • Test activity across different cell types/tissues

    • Implement blinded experimental design where possible

    • Apply appropriate statistical analyses for biological replicates

What are the key properties and specifications of commercially available Recombinant Rat C1orf43 homolog preparations?

PropertySpecificationReference
Full Length1-235 amino acids
Expression SystemE. coli
Molecular Weight~25-26 kDa (with His-tag)
Purity>90% by SDS-PAGE
TagN-terminal His-tag (common)
FormLyophilized powder or liquid in storage buffer
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Long-term Storage-20°C/-80°C
Working Storage4°C for up to one week
ReconstitutionDeionized sterile water (0.1-1.0 mg/mL)
Recommended Additives50% glycerol (final concentration)
UniProt IDQ5XII8

What cross-species homologs have been identified for C1orf43, and what is their sequence conservation?

SpeciesUniProt IDProtein LengthSequence Identity to RatNotes
Rattus norvegicus (Rat)Q5XII8235 aa100% (reference)Used for recombinant production
Homo sapiens (Human)Q9BVM2253 aa~85-90%Also known as NICE-3
Mus musculus (Mouse)Q9CXU9250 aa~95%High conservation with rat
Eufriesea mexicanaXP_017763888.1244 aa~40-45%Insect homolog
Diachasma alloeumXP_015112235.1243 aa~40-45%Insect homolog

Sequence conservation indicates that the C1orf43 protein family is evolutionarily ancient, with homologs present across diverse taxonomic groups. The high conservation between mammalian species suggests important functional roles, while the presence of homologs in insects indicates fundamental cellular functions that have been preserved throughout animal evolution .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.