Recombinant Rat Uncharacterized protein C4orf34 homolog

What is the molecular structure of Recombinant Rat Uncharacterized protein C4orf34 homolog?

Recombinant Rat Uncharacterized protein C4orf34 homolog is a 99-amino acid polypeptide with the sequence: MAEGGFDPCECICSHEHAMRRLINLLRQSQSYCTDTECLRELPGPSGDSGISITVILMAWMVIAVLLFLLRPPNLRGSSLPGKPSSPHSGQDPPAPPVD . The protein has no well-defined functional domains based on current annotations, though the presence of cysteine residues suggests potential for disulfide bond formation that may contribute to its tertiary structure. Structural analysis methods including circular dichroism spectroscopy, X-ray crystallography, or NMR would be required to elucidate its three-dimensional conformation.

How should Recombinant Rat C4orf34 homolog protein be stored for optimal stability?

For optimal stability, store Recombinant Rat C4orf34 homolog protein at -20°C in its supplied buffer (typically Tris-based with 50% glycerol) . For extended storage periods, maintaining the protein at -80°C is recommended. Importantly, repeated freeze-thaw cycles should be avoided as they can compromise protein integrity through denaturation or aggregation . Working aliquots may be kept at 4°C for up to one week to minimize freeze-thaw damage. Prior to experiments, always confirm protein stability via SDS-PAGE analysis to verify integrity and absence of degradation products.

What expression systems are typically used for producing this recombinant protein?

While the specific expression system for commercial Recombinant Rat C4orf34 homolog is not explicitly stated in the search results, recombinant proteins for research applications are commonly produced in prokaryotic (E. coli) or eukaryotic (mammalian, insect, or yeast) expression systems. For proteins requiring post-translational modifications, eukaryotic expression systems are preferred. Bacterial expression in E. coli is common for structural proteins without complex modifications, as demonstrated in the production of unglycosylated recombinant human lacritin . For researchers producing custom recombinant C4orf34 homolog, plasmid DNA containing the target gene can be transformed into competent cells for expression, followed by purification methods appropriate to the expression system selected .

What purification strategies are recommended for isolating Recombinant Rat C4orf34 homolog?

The purification strategy for Recombinant Rat C4orf34 homolog should be tailored to its biochemical properties and the expression system used. A typical workflow includes:

• Initial capture using affinity chromatography if a purification tag (His, GST, etc.) has been incorporated

• Intermediate purification via ion-exchange chromatography, leveraging the protein's charge characteristics

• Polishing step using size-exclusion chromatography to achieve high purity

For tag-free purification, selective precipitation followed by chromatographic methods based on the protein's physicochemical properties is recommended. Purification success should be validated by SDS-PAGE, Western blot analysis using anti-C4orf34 antibodies, and mass spectrometry to confirm protein identity and purity. The methodological approach can be adapted from established protocols for recombinant protein purification as outlined in the literature for other proteins .

How can researchers verify the identity and purity of Recombinant Rat C4orf34 homolog?

Verification of identity and purity requires a multi-method approach:

• SDS-PAGE analysis: To assess protein size and initial purity estimation

• Western blot analysis: Using antibodies specific to C4orf34 homolog or to an incorporated tag

• Mass spectrometry: For precise molecular weight determination and peptide mapping

• N-terminal sequencing: To confirm the protein's identity by matching the first 5-10 amino acids with the expected sequence

• Analytical size-exclusion chromatography: To evaluate oligomeric state and detect aggregation

When conducting Western blot analysis, researchers should follow protocols similar to those used for other recombinant proteins, using appropriate primary antibodies (anti-C4orf34 or anti-tag) and HRP-conjugated secondary antibodies for detection . Visualization can be performed using chemiluminescent substrates followed by digital imaging or autoradiography.

What are the recommended methodologies for studying protein-protein interactions involving C4orf34 homolog?

To investigate protein-protein interactions involving C4orf34 homolog, researchers can employ several complementary techniques:

• Co-immunoprecipitation (Co-IP): Using antibodies against C4orf34 homolog to precipitate the protein along with its binding partners from cell lysates

• Pull-down assays: Utilizing immobilized recombinant C4orf34 homolog to capture interacting proteins from cell extracts

• Yeast two-hybrid screening: For systematic identification of potential interacting partners

• Surface plasmon resonance (SPR): For quantitative analysis of binding kinetics and affinity

• Proximity ligation assay (PLA): For detecting protein interactions in situ with high sensitivity

Each technique should include appropriate controls, including antibody-only controls for Co-IP experiments and irrelevant protein controls for pull-down assays. Data analysis should account for non-specific binding by comparing experimental samples with these controls. The methodological approach can be adapted from standard protocols used for protein interaction studies .

What approaches can be used to determine the cellular localization of C4orf34 homolog?

Determining cellular localization of C4orf34 homolog can be achieved through multiple complementary approaches:

• Immunofluorescence microscopy: Using specific antibodies against C4orf34 homolog or a tagged version of the protein, followed by fluorophore-conjugated secondary antibodies

• Subcellular fractionation: Separating cellular components (nucleus, cytoplasm, mitochondria, etc.) followed by Western blot analysis

• Live-cell imaging: Using GFP-tagged C4orf34 homolog to monitor localization in real-time

• Electron microscopy: For higher resolution localization studies

The immunofluorescence protocol should include:

• Fixation with 4% paraformaldehyde

• Permeabilization with 0.1% Triton X-100

• Blocking with 10% normal goat serum

• Overnight incubation with primary antibodies at 4°C

• Incubation with fluorophore-conjugated secondary antibodies for 1 hour at room temperature

• Nuclear counterstaining with DAPI or ToPro-3

Results should be visualized using confocal microscopy and compared with markers for specific cellular compartments to determine precise localization.

How can researchers investigate the expression pattern of C4orf34 homolog in different rat tissues?

To investigate tissue-specific expression patterns of C4orf34 homolog, researchers should employ a multi-level analysis approach:

• qRT-PCR analysis: To quantify mRNA expression levels across different tissues

  • Extract total RNA from various rat tissues

  • Synthesize cDNA using reverse transcription

  • Perform qPCR with C4orf34-specific primers

  • Normalize to housekeeping genes (e.g., GAPDH or HPRT1)

• Western blot analysis: To determine protein expression levels

  • Prepare protein extracts from different tissues

  • Separate proteins by SDS-PAGE

  • Transfer to PVDF membranes

  • Probe with anti-C4orf34 antibodies

  • Use appropriate loading controls (e.g., Calnexin)

• Immunohistochemistry: To visualize tissue distribution and cellular localization

  • Prepare tissue sections

  • Perform antigen retrieval if necessary

  • Incubate with anti-C4orf34 antibodies

  • Visualize using secondary antibodies and appropriate detection systems

Data should be presented as relative expression levels across tissues, with statistical analysis to identify significant differences in expression patterns.

What experimental approaches can determine if C4orf34 homolog undergoes post-translational modifications?

To investigate post-translational modifications (PTMs) of C4orf34 homolog, researchers should implement:

• Mass spectrometry-based approaches:

  • Tryptic digestion followed by LC-MS/MS analysis

  • Targeted analysis for specific modifications (phosphorylation, glycosylation, etc.)

  • Comparison of theoretical and observed peptide masses

• Biochemical assays:

  • Phosphorylation: Phospho-specific antibodies, phosphatase treatment assays

  • Glycosylation: PNGase F or O-glycosidase treatment followed by mobility shift analysis

  • Ubiquitination: Immunoprecipitation under denaturing conditions followed by ubiquitin-specific antibody detection

• In silico prediction:

  • Utilize bioinformatic tools to predict potential modification sites

  • Compare predictions with experimental data

PTM analysis should include appropriate controls, such as dephosphorylation treatment for phosphorylation studies or deglycosylation enzymes for glycosylation analysis. Results should be presented as comparative analyses showing the effect of treatments on protein mobility or mass.

What strategies can be employed to study the potential function of C4orf34 homolog in cellular models?

To elucidate the function of C4orf34 homolog in cellular models, researchers should consider:

• Gene knockdown/knockout approaches:

  • siRNA or shRNA-mediated knockdown

  • CRISPR-Cas9 genome editing for complete knockout

  • Analysis of resulting phenotypes across multiple cell lines

• Overexpression studies:

  • Transient or stable overexpression of wild-type and mutant forms

  • Assessment of cellular effects including proliferation, morphology, and signaling pathways

• Functional rescue experiments:

  • Restoring the expression in knockout models to validate specificity of observed phenotypes

  • Cross-species comparison with human ortholog to identify conserved functions

• Response to cellular stressors:

  • Exposing cells to various stressors (oxidative stress, ER stress, etc.)

  • Monitoring changes in C4orf34 expression, localization, or modification

Experimental design should include appropriate controls, such as scrambled siRNA for knockdown studies and empty vector controls for overexpression experiments. Multiple independent clones or cell populations should be analyzed to account for clonal variation.

How can researchers investigate potential evolutionary conservation and divergence of C4orf34 homolog across species?

To study evolutionary aspects of C4orf34 homolog, researchers should:

• Comparative sequence analysis:

  • Collect C4orf34 homolog sequences from multiple species

  • Perform multiple sequence alignments to identify conserved regions

  • Calculate sequence identity and similarity percentages

  • Identify species-specific variations

• Phylogenetic analysis:

  • Construct phylogenetic trees to visualize evolutionary relationships

  • Determine the rate of sequence divergence across lineages

  • Identify potential gene duplication events

• Structure prediction and comparison:

  • Generate structural models based on amino acid sequences

  • Compare predicted structures across species to identify conserved structural elements

  • Correlate sequence conservation with structural features

• Functional conservation testing:

  • Express orthologs from different species in knockout cellular models

  • Assess the ability of each ortholog to rescue phenotypes

  • Identify functionally conserved domains through chimeric protein experiments

This multi-faceted approach can reveal insights into the protein's evolutionary history and functional importance across species. The methodology should be adaptable based on the availability of C4orf34 ortholog data, which may be limited for some species .

What approaches can be used to identify transcriptional regulation mechanisms of the C4orf34 homolog gene?

To investigate transcriptional regulation of the C4orf34 homolog gene, researchers should implement:

• Promoter analysis:

  • Identify the promoter region through bioinformatic prediction

  • Clone various lengths of the promoter region into reporter constructs

  • Measure promoter activity under different conditions using luciferase assays

  • Identify minimal promoter region required for expression

• Transcription factor binding studies:

  • Perform in silico analysis to predict transcription factor binding sites

  • Validate predictions using chromatin immunoprecipitation (ChIP)

  • Conduct electrophoretic mobility shift assays (EMSA) to confirm direct binding

  • Use site-directed mutagenesis to assess the functional importance of binding sites

• Epigenetic regulation analysis:

  • Assess DNA methylation status using bisulfite sequencing

  • Analyze histone modifications through ChIP-seq

  • Investigate the effects of epigenetic modifiers on gene expression

• Response to signaling pathways:

  • Treat cells with various pathway activators or inhibitors

  • Monitor changes in C4orf34 expression using qRT-PCR

  • Correlate expression changes with activation/inhibition of specific pathways

Methodological approaches should include appropriate controls and multiple biological replicates to ensure reliability of results.

What are common challenges in working with Recombinant Rat C4orf34 homolog and how can they be addressed?

Common challenges and solutions when working with Recombinant Rat C4orf34 homolog include:

• Protein solubility issues:

  • Optimize buffer conditions (pH, salt concentration, detergents)

  • Consider fusion tags that enhance solubility (MBP, SUMO, etc.)

  • Reduce expression temperature to slow folding and minimize aggregation

  • Use solubility enhancers such as arginine or low concentrations of urea

• Protein stability problems:

  • Add protease inhibitors to prevent degradation

  • Optimize storage conditions and avoid freeze-thaw cycles

  • Consider stabilizing additives such as glycerol or specific ligands

  • Perform stability assays to determine optimal buffer composition

• Low protein yield:

  • Optimize expression conditions (temperature, induction time, media composition)

  • Test different expression systems

  • Improve purification strategy to minimize losses

  • Scale up culture volume to compensate for low expression

• Antibody specificity issues:

  • Validate antibodies using positive and negative controls

  • Consider epitope mapping to identify suitable antibody recognition sites

  • Generate new antibodies using unique peptide sequences from C4orf34

Careful optimization of experimental conditions based on the protein's specific characteristics is essential for addressing these challenges.

How should researchers interpret inconsistent results between different assays studying C4orf34 homolog?

When encountering inconsistent results between different assays, researchers should:

• Evaluate methodological differences:

  • Compare experimental conditions across assays (buffers, temperature, pH, etc.)

  • Assess whether different protein domains are being measured

  • Consider whether assays measure different aspects of the protein (e.g., expression vs. activity)

• Verify reagent quality and specificity:

  • Re-validate antibodies and other detection reagents

  • Confirm protein identity and integrity through independent methods

  • Ensure cell line identity and passage number consistency

• Consider biological variables:

  • Assess cell cycle effects

  • Evaluate possible post-translational modifications

  • Analyze subcellular localization differences

• Reconcile findings through additional experiments:

  • Design experiments that bridge methodological gaps

  • Use orthogonal techniques to corroborate findings

  • Develop unified models that explain apparent contradictions

What statistical approaches are recommended for analyzing quantitative data from C4orf34 homolog experiments?

For robust statistical analysis of C4orf34 homolog experimental data, researchers should:

• Select appropriate statistical tests based on experimental design:

  • t-tests for two-group comparisons with normally distributed data

  • ANOVA for multiple group comparisons

  • Non-parametric tests (Mann-Whitney, Kruskal-Wallis) for non-normally distributed data

  • Correlation analyses for association studies

• Address experimental variability:

  • Perform power analysis to determine adequate sample sizes

  • Implement randomization and blinding where appropriate

  • Include appropriate technical and biological replicates

  • Calculate and report measures of dispersion (standard deviation, standard error)

• Control for multiple comparisons:

  • Apply correction methods (Bonferroni, Benjamini-Hochberg) when performing multiple tests

  • Use post-hoc tests following ANOVA to identify specific group differences

• Implement advanced analyses for complex datasets:

  • Principal component analysis for multidimensional data

  • Hierarchical clustering for expression pattern analysis

  • Machine learning approaches for pattern recognition in large datasets

Statistical methods should be clearly described in research reports, including software packages used, significance thresholds, and specific tests applied to each analysis.