Recombinant Rat Uncharacterized protein ZMYM6NB (Zmym6nb)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Rat Uncharacterized Protein ZMYM6NB (Zmym6nb)

Recombinant Rat Uncharacterized Protein ZMYM6NB (Zmym6nb) is a protein that, as its name suggests, has not yet been fully characterized . The gene name associated with Zmym6nb is Tmem35b, which is also referred to as Transmembrane protein 35B .

Basic Information

CategoryDescription
SynonymsTmem35b; Zmym6nb; Transmembrane protein 35B; ZMYM6 neighbor protein
SpeciesRat
SourceE. coli or Baculovirus
TagHis-Tag. Tag type is determined during manufacturing .
Protein LengthFull Length of Mature Protein (22-152aa) or Partial
AA SequenceAKLFQVSAPVSQQMKALFEQFAEVFPLKVLGYQPDPISYQAAVGWLELLAGLLLVVGPPVLQQISNVLLILLMMGAVFTLVVLEESLSTYIPAVVCLGLLLLLDSCQFLVRTKGAVRCRNKIPGALGNPRK
PurityGreater than 85% or 90% as determined by SDS-PAGE
FormLyophilized powder or Liquid
StorageStore at -20°C/-80°C upon receipt, avoid repeated freeze-thaw cycles .
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionReconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃ .
UniProt IDD3ZYP5
Application NotesRepeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week .

Function and Pathways

The protein encoded by the Tmem35b gene participates in several biochemical functions and interacts with other proteins and molecules . Further studies are required to elucidate the precise function of Zmym6nb.

Availability

Recombinant Rat Uncharacterized Protein ZMYM6NB (Zmym6nb) is available for purchase from Creative BioMart and CUSABIO as a product for life science research .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Tmem35b; Zmym6nb; Transmembrane protein 35B; ZMYM6 neighbor protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
22-152
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Tmem35b
Target Protein Sequence
AKLFQVSAPVSQQMKALFEQFAEVFPLKVLGYQPDPISYQAAVGWLELLAGLLLVVGPPV LQQISNVLLILLMMGAVFTLVVLEESLSTYIPAVVCLGLLLLLDSCQFLVRTKGAVRCRN KIPGALGNPRK
Uniprot No.

Target Background

Database Links

KEGG: rno:100361631

UniGene: Rn.118708

Protein Families
DoxX family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

How does rat ZMYM6NB compare to orthologs in other species?

The human ZMYM6NB fragment (specifically amino acids 131-154) shows moderate sequence identity with mouse and rat orthologs (approximately 46% for both) . This limited conservation suggests potential species-specific functions that researchers should consider when extrapolating findings across species. When designing experiments, it's advisable to verify functional conservation experimentally rather than assuming complete functional homology based on sequence similarity.

What expression systems are optimal for recombinant rat ZMYM6NB production?

Recombinant rat ZMYM6NB has been successfully expressed in bacterial systems, particularly E. coli . Unlike some other recombinant proteins that require eukaryotic expression systems for proper folding or post-translational modifications, ZMYM6NB can be produced in prokaryotic systems with adequate yield and activity.

When expressing in E. coli, consider these methodological approaches:

  • Use of an N-terminal His-tag to facilitate purification

  • Expression of the mature protein sequence (amino acids 22-152)

  • Optimization of codon usage for E. coli if expression levels are suboptimal

  • Testing multiple E. coli strains (BL21, Rosetta, etc.) to determine optimal expression

For applications requiring post-translational modifications, mammalian or insect cell expression systems may be preferable, though this approach has been less commonly reported in the literature for this specific protein.

What are the recommended storage and handling conditions for recombinant rat ZMYM6NB?

Based on standard protocols for similar recombinant proteins, the following storage and handling recommendations apply to rat ZMYM6NB:

FormStorage TemperatureBuffer CompositionAdditional Recommendations
Lyophilized-20°C to -80°CN/AUse desiccant; avoid moisture exposure
Reconstituted-20°C to -80°C (long-term); 4°C (up to one week)Tris-based buffer with 50% glycerol Aliquot to avoid freeze-thaw cycles

The protein is typically shipped at ambient temperature and should be stored immediately upon receipt at the recommended temperature . For optimal stability, use a manual defrost freezer and avoid repeated freeze-thaw cycles, as these can significantly reduce protein activity and integrity .

What are the optimal reconstitution methods for lyophilized recombinant rat ZMYM6NB?

For carrier-free versions of the protein, reconstitute at 100 μg/mL in PBS . For versions containing bovine serum albumin (BSA) as a carrier protein, reconstitute at 100 μg/mL in PBS containing at least 0.1% human or bovine serum albumin .

Methodological considerations for reconstitution:

  • Centrifuge the vial before opening to ensure all material is at the bottom

  • Add reconstitution buffer gently down the sides of the vial

  • Allow several minutes for complete reconstitution without vortexing

  • For prolonged storage after reconstitution, dilute to working aliquots in a 0.1% BSA solution

The reconstitution approach should be tailored to your specific experimental requirements and downstream applications.

How can I verify the identity and purity of recombinant rat ZMYM6NB preparations?

Multiple complementary approaches are recommended for thorough characterization:

  • SDS-PAGE analysis: Expected molecular weight is approximately 15-17 kDa for the native protein, with potential variation depending on tags and expression systems used. Purity should exceed 90% for most applications .

  • Western blotting: Using antibodies against ZMYM6NB or the affinity tag (e.g., His-tag). Note that due to the uncharacterized nature of this protein, commercial antibodies may have limited availability or specificity.

  • Mass spectrometry: For definitive identification and to verify sequence integrity.

  • N-terminal sequencing: To confirm protein identity, particularly for truncated versions.

A comprehensive verification protocol should include at least SDS-PAGE for purity assessment and one identification method such as western blotting or mass spectrometry.

What functional assays can be used to characterize rat ZMYM6NB activity?

Given the limited characterization of ZMYM6NB, functional assays should be designed based on predicted functions and homology to better-characterized family members:

  • Protein-protein interaction studies: Co-immunoprecipitation experiments similar to those used for ZMYM2 and ZMYM4 to identify binding partners . Consider testing interactions with transcription factors like B-MYB based on known interactions of other ZMYM family members.

  • Transcriptional regulation assays: Luciferase reporter assays to investigate potential transcriptional regulatory activity, similar to those used with ZMYM2 and ZMYM4 .

  • Subcellular localization studies: Immunofluorescence or fractionation studies to determine cellular localization, which may provide functional insights.

  • Cell cycle analysis: Flow cytometry to assess potential roles in cell cycle regulation, particularly G1/S transition, as observed with ZMYM2 .

How can I design knockdown experiments to study ZMYM6NB function in cellular models?

RNA interference approaches using siRNA have been developed for ZMYM6NB in mouse models and could be adapted for rat studies . When designing knockdown experiments:

  • siRNA design considerations:

    • Target multiple regions of the transcript using 3+ different siRNA sequences

    • Validate knockdown efficiency using qPCR and western blot

    • Include appropriate negative controls (scrambled siRNA)

  • Recommended experimental protocol:

    • Transfect cells using standard transfection reagents

    • Verify knockdown efficiency after 48-72 hours

    • Assess phenotypic consequences focusing on cellular processes implicated for ZMYM family members (transcription, cell cycle progression, DNA damage response)

For higher specificity and long-term studies, CRISPR-Cas9 genome editing might be preferable to create knockout models, though this requires additional validation steps.

What are the current hypotheses regarding ZMYM6NB function based on related family members?

Based on research with related ZMYM family proteins, several hypotheses about ZMYM6NB function can be proposed:

  • Potential role in transcriptional regulation: Like ZMYM2 and ZMYM4, ZMYM6NB may function as a transcriptional regulator. ZMYM4 enhances transcriptional activity while ZMYM2 shows repressive effects .

  • Cell cycle involvement: ZMYM2 is implicated in G1/S phase progression, particularly in specific cell types such as HepG2 cells . ZMYM6NB may have cell-type specific roles in cell cycle regulation.

  • DNA damage response pathway: ZMYM4 interaction with B-MYB is stimulated upon induction of DNA damage , suggesting potential roles for ZMYM family proteins, including possibly ZMYM6NB, in DNA damage response pathways.

  • Developmental processes: ZMYM family members have been implicated in developmental processes. ZMYM2 and ZMYM4 are required for craniofacial development and show effects on neural crest cells and otic vesicle formation when knocked down .

These hypotheses should guide experimental design while researchers remain open to discovering unique functions for ZMYM6NB.

How can structural analysis inform functional studies of ZMYM6NB?

While detailed structural data for ZMYM6NB is limited, bioinformatic and experimental approaches can provide valuable insights:

  • In silico analysis:

    • Sequence-based secondary structure prediction

    • Homology modeling based on related ZMYM proteins

    • Domain prediction to identify functional motifs

  • Experimental structure determination:

    • X-ray crystallography of recombinant protein

    • NMR for smaller domains

    • Hydrogen-deuterium exchange mass spectrometry to identify flexible regions

  • Structural-functional correlations:

    • Mutagenesis of predicted functional domains followed by activity assays

    • Deletion mapping to identify minimal functional regions

Understanding the structural features of ZMYM6NB will help guide hypotheses about protein-protein interactions and potential enzymatic functions.

What are appropriate experimental controls when studying an uncharacterized protein like ZMYM6NB?

When designing experiments with poorly characterized proteins, robust controls are essential:

  • Expression validation controls:

    • Western blot with tag-specific antibodies for recombinant protein

    • Parallel experiments with vector-only or GFP-expressing controls

    • Inclusion of known related proteins (e.g., other ZMYM family members) when possible

  • Functional assay controls:

    • Both positive and negative controls in protein-protein interaction studies

    • Appropriate cellular backgrounds (wild-type, knockout, knockdown)

    • Complementation experiments with mutant versions to validate specificity

  • Specificity controls:

    • Blocking peptides for antibody validation

    • Multiple siRNA sequences targeting different regions of the transcript

    • Rescue experiments following knockdown

How should contradictory results in ZMYM6NB research be interpreted?

Given the uncharacterized nature of ZMYM6NB, contradictory results may emerge as research progresses. A systematic approach to resolving such contradictions includes:

  • Cell type and context specificity: ZMYM family proteins may have cell-type specific effects. ZMYM2 knockdown impairs G1/S-phase progression in HepG2 cells but shows no obvious effects on HEK293 cells . Document all experimental conditions thoroughly.

  • Protein interaction networks: The function of ZMYM6NB may depend on available interaction partners, which vary between systems and conditions. Consider characterizing the interactome in your specific experimental system.

  • Post-translational modifications: ZMYM4 is highly SUMOylated , and modifications may alter function. Consider investigating the modification state of ZMYM6NB in different contexts.

  • Experimental approach validation: Use multiple complementary techniques to verify findings, as each method has inherent limitations and biases.

When publishing research on uncharacterized proteins like ZMYM6NB, clearly document all methodological details to facilitate replication and comparison across studies.

What are promising research directions for understanding ZMYM6NB function?

Based on current knowledge of the ZMYM protein family, several research directions are particularly promising:

  • Comprehensive interactome mapping: Identify ZMYM6NB binding partners through approaches such as BioID, immunoprecipitation coupled to mass spectrometry, or yeast two-hybrid screening.

  • Transcriptomic impact assessment: RNA-seq analysis following ZMYM6NB overexpression or knockdown to identify regulated genes and pathways.

  • Cell cycle and DNA damage response: Detailed analysis of ZMYM6NB expression, localization, and protein modifications throughout the cell cycle and following DNA damage.

  • Developmental roles: Investigation of ZMYM6NB expression patterns and function during development, particularly in tissues where other ZMYM proteins play important roles.

  • Cross-species functional conservation: Comparative analysis of ZMYM6NB function across species to identify conserved and divergent roles.

What experimental design would best examine potential roles of ZMYM6NB in the DNA damage response?

Based on the observation that ZMYM4-B-MYB interaction is stimulated upon DNA damage induction , a systematic approach to investigating ZMYM6NB in this context would include:

  • Expression and localization dynamics:

    • Western blot and immunofluorescence analysis of ZMYM6NB before and after DNA damage induction

    • Time-course experiments with various DNA damaging agents (UV, ionizing radiation, chemotherapeutics)

  • Protein-protein interactions:

    • Co-immunoprecipitation of ZMYM6NB before and after DNA damage

    • Proximity ligation assays to detect protein interactions in situ

    • Mass spectrometry to identify damage-specific interaction partners

  • Functional impact assessment:

    • ZMYM6NB knockdown/knockout followed by DNA damage sensitivity assays

    • Analysis of DNA repair pathway activation in ZMYM6NB-depleted cells

    • Cell cycle checkpoint activation assessment

  • Post-translational modification analysis:

    • Mass spectrometry to identify damage-induced modifications

    • Mutational analysis of identified modification sites

This experimental approach would provide a comprehensive picture of potential ZMYM6NB involvement in DNA damage response pathways.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.