Recombinant Rat UPF0414 transmembrane protein C20orf30 homolog

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Rat UPF0414 Transmembrane Protein C20orf30 Homolog

The "Recombinant Rat UPF0414 transmembrane protein C20orf30 homolog" refers to a protein in rats that is similar to a human protein known as transmembrane protein 230 (TMEM230) . TMEM230 is a protein-coding gene in humans . The rat homolog is officially known as Tmem230 .

Synonyms and Identifiers

The rat protein has several synonyms and identifiers :

  • Synonyms: UPF0414 transmembrane protein C20orf30, UPF0414 transmembrane protein C20orf30 homolog, putative UPF0414 transmembrane protein C20orf30 like protein.

  • Symbol: Tmem230

  • NCBI Gene ID: 29058

Basic Information

Information regarding the Recombinant Rat UPF0414 transmembrane protein C20orf30 homolog:

PropertyValue
Chemical NameRecombinant Rat UPF0414 transmembrane protein C20orf30 homolog
Molecular Weight0
CBNumberCB115634998
CAS NumberNot available
Molecular FormulaNot available

Function and Location

The rat Tmem230 protein is predicted to be involved in axonal transport and synaptic vesicle transport and is active in the synaptic vesicle membrane . The human TMEM230 protein, which the rat protein is homologous to, is a multi-pass transmembrane protein that localizes to secretory and endosomal pathways and the plasma membrane .

Homology

To find homologs of the gene, databases such as HomoloGene and Gene database can be searched using the gene name . If these searches yield no results, the Protein database can be searched using a protein accession number .

Role in Disease

The rat Tmem230 is associated with Parkinson's disease . Research indicates that mutations in TMEM230 might not contribute to the development of familial Parkinson's disease .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Tmem230; Transmembrane protein 230
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Tmem230
Target Protein Sequence
MMPSRTNLATGIPSSKVKYSRLSSTDDGYIDLQFKKSPPKIPYKAIALATVLFLIGTFLI IIGSLLLSGYISKGGADRAVPVLIIGILVFLPGFYHLRIAYYASKGYRGYSYDDIPDFDD
Uniprot No.

Target Background

Function
This protein is involved in the trafficking and recycling of synaptic vesicles.
Database Links
Protein Families
TMEM134/TMEM230 family
Subcellular Location
Membrane; Multi-pass membrane protein. Cytoplasmic vesicle, secretory vesicle, synaptic vesicle. Golgi apparatus, trans-Golgi network. Early endosome. Recycling endosome. Late endosome. Cytoplasmic vesicle, autophagosome.

Q&A

How should Recombinant Rat UPF0414 transmembrane protein C20orf30 homolog be stored and handled for optimal stability?

For optimal stability and activity of Recombinant Rat UPF0414 transmembrane protein C20orf30 homolog, the following storage and handling guidelines should be followed:

Storage ConditionRecommendationDuration
Short-term storage4°CUp to one week
Standard storage-20°CSeveral months
Long-term storage-80°CExtended periods
Buffer conditionsTris-based buffer with 50% glycerolOptimized for stability

Repeated freeze-thaw cycles should be avoided as they can compromise protein integrity. It is recommended to prepare small working aliquots to minimize the need for repeated thawing of the original stock .

When working with the protein, maintain aseptic conditions and use sterile solutions to prevent contamination. If needed for specific experiments, carrier-free formulations may be preferable to avoid interference from carrier proteins in sensitive assays, similar to other transmembrane proteins .

What are the known homologs of UPF0414 transmembrane protein C20orf30 across different species?

UPF0414 transmembrane protein C20orf30 has several homologs across mammalian species, with varying degrees of sequence conservation:

SpeciesHomolog NameUniProt IDSequence Identity to RatKey Differences
Rat (Rattus norvegicus)UPF0414 transmembrane protein C20orf30 homologQ5BJP5100%Reference sequence
Mouse (Mus musculus)UPF0414 transmembrane protein C20orf30 homologQ8CIB6~98%Minor amino acid substitutions at positions 53-54 (ST→AS)
Human (Homo sapiens)TMEM230 (Transmembrane protein 230)Q96A57~48%Conserved functional domains with different flanking sequences

The highly conserved region across species is the RIAYYASKGYRGYSYDDIPDFDD sequence, suggesting this may be functionally significant . The mouse and rat homologs share almost identical amino acid sequences, suggesting they likely serve similar functions, while the human ortholog shows greater divergence but maintains key functional domains .

What methodologies are most effective for studying the membrane topology of UPF0414 transmembrane protein C20orf30 homolog?

Determining the membrane topology of UPF0414 transmembrane protein C20orf30 homolog requires specialized approaches to understand how its segments are oriented relative to the lipid bilayer. Based on research with similar transmembrane proteins, the following methodologies have proven effective:

  • Protease Protection Assays: Using membrane-impermeable proteases to cleave exposed protein domains while leaving membrane-embedded or lumenal domains intact. Subsequent analysis by western blotting using domain-specific antibodies can reveal which segments are accessible.

  • Site-Directed Fluorescence Labeling: Introducing cysteine residues at strategic positions and labeling with membrane-impermeable fluorescent dyes to determine which regions are accessible from which side of the membrane .

  • BioID Proximity Labeling: Fusing BirA* biotin ligase to either the N or C-terminus of the protein and identifying biotinylated proteins by mass spectrometry to map interaction networks and infer topology . This method has provided valuable insights for other transmembrane proteins with unclear topology.

  • Computational Prediction Combined with Experimental Validation: Hydropathy analysis using algorithms like TMHMM, combined with experimental validation through techniques like glycosylation mapping, where potential glycosylation sites are introduced and their modification status assessed10.

Based on hydrophobicity analysis of the amino acid sequence (positions 59-81 and 84-106), the protein likely contains at least two transmembrane domains, with hydrophobic residues (particularly leucine) enriched in these membrane-spanning regions 10.

How can researchers overcome the challenges of expressing and purifying functional Recombinant Rat UPF0414 transmembrane protein C20orf30 homolog?

Expressing and purifying functional transmembrane proteins presents significant challenges. For Recombinant Rat UPF0414 transmembrane protein C20orf30 homolog, these challenges can be addressed through the following optimized protocols:

  • Expression System Selection:

    • E. coli: While commonly used, it may not provide proper post-translational modifications

    • Recommended: Insect cell systems (Sf9 or High Five™) provide better folding and processing for mammalian transmembrane proteins

    • For highest fidelity: Mammalian cell lines (HEK293 or CHO) maintain native folding environment

  • Fusion Tags and Constructs:

    Tag TypePositionAdvantagesConsiderations
    His-tagN-terminalEfficient purificationMay affect N-terminal topology
    SUMO tagN-terminalEnhanced solubilityRequires SUMO protease cleavage
    Fc-fusionC-terminalImproved stability, easy detectionLarger tag may alter function
    Split-GFPC-terminalMonitors proper foldingRequires complementation system
  • Solubilization and Stabilization:

    • Mild detergents (DDM, LMNG) at concentrations just above CMC

    • Lipid nanodiscs or amphipols for maintaining native-like environment

    • Addition of cholesterol and specific phospholipids to stabilize structure

  • Functional Validation:

    • Circular dichroism to confirm secondary structure integrity

    • Fluorescence-based assays to assess membrane insertion

    • Liposome-based assays to test functional parameters

The most critical factors for success are maintaining the protein in a native-like membrane environment throughout purification and minimizing exposure to harsh detergents that could disrupt the transmembrane domains. Adding carrier proteins such as BSA during storage and handling can enhance stability for downstream applications .

What are the most promising research applications for Recombinant Rat UPF0414 transmembrane protein C20orf30 homolog in neurodegenerative disease models?

Based on its putative role in synaptic vesicle trafficking and the importance of membrane protein dysfunction in neurodegenerative diseases, Recombinant Rat UPF0414 transmembrane protein C20orf30 homolog shows promise in several research applications:

  • Parkinson's Disease Models:

    • The human homolog (TMEM230) has been implicated in vesicle trafficking , which is particularly relevant to Parkinson's pathophysiology

    • Applications include studying:

      • Alpha-synuclein aggregation and clearance mechanisms

      • Synaptic dysfunction in dopaminergic neurons

      • Potential protective mechanisms against neurodegeneration

  • Alzheimer's Disease Research:

    • Membrane protein dysfunction contributes to amyloid-beta processing

    • UPF0414 could be studied in relation to:

      • Synaptic vesicle recycling deficits observed in early disease stages

      • Membrane composition alterations affecting amyloid precursor protein processing

      • Potential role in maintaining synaptic homeostasis

  • Comparative Studies with Nogo-A:
    Nogo-A, another well-studied transmembrane protein involved in neuronal health, provides a useful comparative model:

    CharacteristicUPF0414/TMEM230Nogo-AResearch Implications
    Primary functionSynaptic vesicle traffickingAxon growth inhibitionComplementary roles in neuronal health
    Therapeutic targetingUnexploredAntibody therapies in developmentPotential for similar approaches
    Expression patternBroad neuronal expressionOligodendrocytes, neuronsDifferent cellular targets
    Structural featuresMultiple transmembrane domainsReticulon family with conserved C-terminusDifferent membrane topology
  • Methodological Approaches:

    • Development of fluorescently-tagged constructs to monitor trafficking dynamics in living neurons

    • Creation of domain-specific antibodies to probe structure-function relationships

    • Application of proximity labeling techniques to identify interaction partners in different disease states

    • Generation of conditional knockout models to assess temporal requirements in disease progression

The anti-apoptotic potential suggested by studies of related proteins (like TMEM14A) indicates that UPF0414 might serve protective functions in neurons under stress conditions, making it a particularly interesting target for neuroprotective strategies .

How can Recombinant Rat UPF0414 transmembrane protein C20orf30 homolog be used in developing targeted drug delivery systems for neurological disorders?

Recombinant Rat UPF0414 transmembrane protein C20orf30 homolog offers unique opportunities for developing targeted drug delivery systems for neurological disorders due to its specific localization and function in neuronal membranes:

  • Liposome-Based Delivery Systems:

    • Incorporation of UPF0414-derived peptides into liposomal formulations can enhance targeting to specific neuronal populations

    • The transmembrane domains can be utilized to create stable anchoring in synthetic membranes

  • Exosome Engineering:

    • Expressing UPF0414 or its functional domains in exosome-producing cells can create naturally derived nanoparticles with enhanced neuronal targeting

    • This approach leverages the protein's natural role in vesicle trafficking

    • Key advantages include biocompatibility and ability to cross the blood-brain barrier

  • Peptide-Conjugated Nanoparticles:
    Based on sequence analysis of UPF0414, several peptide regions show potential for targeting applications:

    Peptide RegionSequencePotential Application
    TM domain 1AIALATVLFLIGTFLIMembrane penetration enhancer
    Cytoplasmic domainYRGYSYDDIPDFDDIntracellular delivery targeting
    Extracellular loopGGADRAVPVLIIGICell-type specific recognition
  • Functionally Guided Approaches:

    • Development of small molecule modulators of UPF0414 function could selectively enhance or inhibit specific neuronal activities

    • Potential applications include:

      • Enhancing synaptic vesicle recycling in neurodegenerative conditions

      • Modulating neurotransmitter release in psychiatric disorders

      • Promoting neuronal survival through anti-apoptotic mechanisms

  • Experimental Validation Approaches:

    • In vitro blood-brain barrier models to assess penetration efficiency

    • Neuronal-glial co-cultures to evaluate cell-type specificity

    • Functional assays measuring neurotransmitter release in response to targeted interventions

    • In vivo imaging to track biodistribution and target engagement

The development of such targeted delivery systems would benefit from integrating knowledge about the protein's membrane topology, interaction partners, and tissue-specific expression patterns to maximize specificity and efficacy 10 .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.