Recombinant Rat Urotensin-2 receptor (Uts2r)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, specify your preferred tag type for prioritized development.
Note: While the tag type is determined during production, specify your preferred tag type for prioritized development.
Synonyms
Uts2r; Gpr14; Senr; Urotensin-2 receptor; UR-2-R; G-protein coupled receptor 14; G-protein coupled sensory epithelial neuropeptide-like receptor; SENR; Urotensin II receptor; UR-II-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-386
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MALSLESTTSFHMLTVSGSTVTELPGDSNVSLNSSWSGPTDPSSLKDLVATGVIGAVLSA
MGVVGMVGNVYTLVVMCRFLRASASMYVYVVNLALADLLYLLSIPFIIATYVTKDWHFGD
VGCRVLFSLDFLTMHASIFTLTIMSSERYAAVLRPLDTVQRSKGYRKLLVLGTWLLALLL
TLPMMLAIQLVRRGSKSLCLPAWGPRAHRTYLTLLFGTSIVGPGLVIGLLYVRLARAYWL
SQQASFKQTRRLPNPRVLYLILGIVLLFWACFLPFWLWQLLAQYHEAMPLTPETARIVNY
LTTCLTYGNSCINPFLYTLLTKNYREYLRGRQRSLGSSCHSPGSPGSFLPSRVHLQQDSG
RSLSSSSQQATETLMLSPVPRNGALL
Uniprot No.
Target Background
Function
The recombinant rat Urotensin-2 receptor (Uts2r) is a high-affinity receptor for urotensin-2 and urotensin-2B. Its activity is G-protein mediated, activating a phosphatidylinositol-calcium second messenger system.
Gene References Into Functions
Functional Studies of the Urotensin-2 Receptor (GPR14):
- Increased GPR14 mRNA and protein expression in the brains of rats subjected to cerebral ischemia. PMID: 24878476
- Identification of key transmembrane domain 1 and 2 residues in the urotensin-II receptor (UT) that contribute to the receptor's binding pocket. PMID: 25175740
- Significant role of dynamic urotensin II receptor changes in pulmonary arterioles in the development of pulmonary hypertension and remodeling induced by chronic hypoxia-hypercapnia in rats. PMID: 21180151
- Specific nuclear/perinuclear expression of the U-II receptor in rat heart, showing differential effects on transcription upon activation by U-II or URP. PMID: 22044114
- Evidence for functional nuclear UT in various rat and monkey tissues, as well as human cell lines. PMID: 22245063
- Urotensin II receptor blockade improved hypoxia-induced cardiac hypertrophy. PMID: 20870804
- High, medium, and low expression of the urotensin II receptor in the rat brain's arcuate, paraventricular, and pedunculopontine tegmental nuclei, respectively. PMID: 20422157
- Significant role of U-II and the urotensin II receptor in diabetic angiopathy, particularly in large arteries. PMID: 19906507
- Interaction between phenylalanine at position 6 of urotensin-II and Met(184) and/or Met(185) of the urotensin-II receptor's fourth transmembrane domain. PMID: 12495432
- Cellular localization of GPR14 receptor protein and a positive inotropic effect of urotensin II in normal rat heart. PMID: 15273242
- Internalization of the UT receptor, with specific serine residues in the receptor's cytoplasmic tail playing a role. PMID: 15458389
- Urotensin II-related peptide as the endogenous and functional ligand for the urotensin II receptor in rats (review). PMID: 15476951
- Analysis of urotensin-II binding sites in the Sprague-Dawley rat renal medulla. PMID: 16290260
- Rat astrocytes expressing high- and low-affinity UII binding sites coupled to G proteins, with the high-affinity receptor exhibiting characteristics similar to UT. PMID: 16942596
- Urotensin II-related peptide as the endogenous and functional ligand for the urotensin II receptor GPR14 in rats, mice, and possibly humans. PMID: 17628210
- Differential expression of urotensin II receptors in rat and human cardiovascular tissues, potentially explaining diverse vascular actions of urotensin-II. PMID: 17905478
- Comparison of urotensin II-related peptide (URP) analogs' ability to compete for [125I]URP binding and modulate cytosolic calcium concentration in cultured rat astrocytes. PMID: 18082287
- Significantly enhanced urotensin 2 receptor expression in the myocardium of diabetic rats, at both mRNA and protein levels. PMID: 18280445
- Potential of the antagonist palosuran as a new therapeutic option in liver cirrhosis with portal hypertension. PMID: 18318439
- Major contribution of the conserved Asp(2.50) residue to UT receptor functionality. PMID: 18509066
- Higher UII and UT mRNA expression in the renal medulla than cortex of SHR and WKY rats, with up to threefold higher expression in SHR tissue. PMID: 18701623
- Increased urotensin 2 receptor expression in the kidneys of hypertensive or renal failure patients. PMID: 18955095
- Significantly elevated urotensin II receptor mRNA expression in the aorta of 11-12-week-old SHR compared to age-matched WKY rats, similar to kidney expression levels. PMID: 19463745
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Preferentially expressed in neural and sensory tissues.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
