Recombinant Rat V-type proton ATPase 16 kDa proteolipid subunit (Atp6v0c)

Shipped with Ice Packs
In Stock

Description

Definition and Molecular Context

Recombinant Rat V-type proton ATPase 16 kDa proteolipid subunit (Atp6v0c) is a genetically engineered protein component of vacuolar ATPase (V-ATPase), a multisubunit enzyme critical for organelle acidification in eukaryotic cells. This subunit forms part of the transmembrane V0 domain, which facilitates proton transport across membranes via a rotary mechanism .

Functional Roles in Cellular Processes

Atp6v0c is essential for V-ATPase activity, which regulates:

  • Organelle acidification: Maintains lysosomal pH for protein degradation and autophagy .

  • Synaptic vesicle proton gradients: Critical for neurotransmitter storage and release .

  • Extracellular pH modulation: Influences tumor metastasis by altering proton efflux in cancer cells .

Key Research Findings:

  • Autophagy Dysregulation: Knockdown of Atp6v0c in SH-SY5Y neuroblastoma cells increased LC3-II and α-synuclein aggregates, indicating impaired autophagic flux .

  • Epilepsy and Neurodevelopment: Heterozygous ATP6V0C mutations (e.g., Ala22Thr) disrupt hydrogen bonding in the c-ring, altering proton transport and correlating with febrile seizures .

  • Cancer Metastasis: Silencing Atp6v0c in prostate cancer cells reduced V-ATPase activity and extracellular H+ concentration, inhibiting migration .

Research Applications

Recombinant Atp6v0c is widely used to study:

  1. Neurodegenerative Diseases: Role in α-synuclein and amyloid precursor protein (APP) metabolism .

  2. Epilepsy Mechanisms: Structural impact of mutations on V-ATPase function .

  3. Cancer Biology: Proton pump inhibition as a therapeutic strategy .

Table 2: Experimental Models and Outcomes

Model SystemKey OutcomeSource
SH-SY5Y NeuroblastomaImpaired autophagic flux and neurite shortening post-knockdown
DrosophilaIncreased seizure duration with Atp6v0c knockdown
PC-3M-1E8 Prostate CellsReduced extracellular H+ and metastasis inhibition

Mutation Analysis and Pathological Implications

Missense (e.g., Ala22Thr) and frameshift mutations in ATP6V0C are linked to:

  • Neurodevelopmental disorders: Corpus callosum hypoplasia, epilepsy .

  • Molecular instability: Ala22Thr reduces protein stability (ΔΔG = -0.76 kcal/mol) and introduces aberrant hydrogen bonds .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
Atp6v0c; Atp6c; Atp6l; Atpl; V-type proton ATPase 16 kDa proteolipid subunit; V-ATPase 16 kDa proteolipid subunit; Vacuolar proton pump 16 kDa proteolipid subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-155
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MADIKNNPEYSSFFGVMGASSAMVFSAMGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVV MAGIIAIYGLVVAVLIANSLTDGITLYRSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRG TAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK
Uniprot No.

Target Background

Function
This protein is the proton-conducting pore-forming subunit of the membrane integral V0 complex of vacuolar ATPase. V-ATPase is responsible for acidifying various intracellular compartments in eukaryotic cells.
Database Links
Protein Families
V-ATPase proteolipid subunit family
Subcellular Location
Vacuole membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of the ATP6V0C protein?

ATP6V0C is a 155-amino acid protein that comprises five topological domains and four transmembrane domains. Three topological domains (amino acids 1-10, 77-92, and 153-155) are located within the lumen, while two domains (amino acids 34-55 and 115-131) face the cytoplasm. The four helical domains (amino acids 11-33, 56-76, 93-114, and 132-152) span the membrane . The c-subunit forms part of the proteolipid c-ring in the membrane-bound V0 domain of the V-type ATPase complex, which is critical for proton translocation across membranes .

How does ATP6V0C contribute to V-ATPase function?

ATP6V0C serves as the proton-conducting pore-forming subunit within the V0 complex of vacuolar H+-ATPase. This multisubunit enzyme consists of a peripheral V1 complex that hydrolyzes ATP and the membrane-integral V0 complex that translocates protons . The c-subunit, along with the c″ subunit (encoded by ATP6V0B), forms the intramembrane c-ring that facilitates proton movement across the membrane. A glutamate residue at position 139 (p.E139) in ATP6V0C and an arginine residue (p.R735) in ATP6V0A are essential for proton translocation . The c-ring couples the energy generated by ATP hydrolysis to proton movement from the cytosol to the lumen through the hemichannel formed between the a-subunit and the proteolipid c-ring .

What cellular compartments express ATP6V0C and what is its role in cellular physiology?

ATP6V0C is expressed in intracellular compartments where V-ATPase functions to acidify and maintain the pH of organelles. In some cell types, it is also targeted to the plasma membrane, where it contributes to acidification of the extracellular environment . The protein operates in concert with other proteins such as ATP6V1A and ClC-7 to regulate proton transport and lysosomal function, linking it closely to cellular energy metabolism and nutrient sensing pathways . This pH regulation is crucial for membrane trafficking by several different types of transporters .

What are the validated methods for detecting ATP6V0C in experimental systems?

Based on available tools, ATP6V0C can be detected using specific antibodies suitable for Western blotting (WB) and immunohistochemistry on paraffin-embedded tissues (IHC-P). Validated antibodies have been developed against synthetic peptides corresponding to amino acids 100-150 of human ATP6V0C, which also cross-react with mouse ATP6V0C . For functional studies, researchers can assess V-ATPase activity using LysoSensor fluorescence to measure organelle acidification, as demonstrated in studies with Saccharomyces cerevisiae .

How can researchers generate and validate ATP6V0C mutants for functional studies?

To generate ATP6V0C mutants for functional studies, researchers typically employ site-directed mutagenesis on expression vectors containing the ATP6V0C gene. Various model organisms have been used successfully for functional validation of ATP6V0C variants, including:

  • Yeast (Saccharomyces cerevisiae) - Allows assessment of growth in media containing varying concentrations of CaCl₂ and measurement of LysoSensor fluorescence

  • Drosophila - Enables evaluation of seizure-like behavior following ATP6V0C knockdown

  • Caenorhabditis elegans - Permits analysis of growth, motor function, and lifespan when expressing patient variants

Validation should include both structural prediction using tools like Phyre2 and AlphaFold for missense variants and functional assays measuring proton transport activity .

What methods are effective for studying ATP6V0C interactions with other V-ATPase subunits?

To investigate ATP6V0C interactions with other V-ATPase subunits, researchers can employ:

  • Computational modeling: In silico modeling using tools like Phyre2 and AlphaFold can predict how variants affect interactions between ATP6V0C and other subunits, particularly ATP6V0A during ATP hydrolysis

  • Co-immunoprecipitation assays: To detect physical interactions between ATP6V0C and other V-ATPase components

  • Three-dimensional structure analysis: Using PyMOL for visualization and analysis of protein models to determine specific interaction sites and hydrogen bonding patterns between subunits

  • Protein stability assessments: Tools like I-Mutant 3.0 can be used to predict the effect of missense variants on protein stability through free energy change value (DDG, Kcal/mol) calculations

What neurodevelopmental disorders are associated with ATP6V0C variants?

Heterozygous variants in ATP6V0C have been identified in patients with a spectrum of neurodevelopmental abnormalities with or without epilepsy. Clinical features include developmental delay, intellectual disability, corpus callosum hypoplasia, and in some cases, cardiac abnormalities . Additionally, ATP6V0C mutations have been specifically associated with febrile seizures (FS) and epilepsy with febrile seizures plus (EFS+) . In a study of 27 patients with ATP6V0C variants, 22 had missense substitutions, four had frameshifting variants, and one had a stop-loss variant. Some variants (p.A138P, p.A149T, and p.L150F) were recurrent, being found in multiple unrelated individuals .

What molecular mechanisms underlie ATP6V0C-related pathologies?

The pathogenic mechanisms of ATP6V0C variants involve disruption of V-ATPase function through several possible pathways:

  • Interference with ATP6V0C-ATP6V0A subunit interactions during ATP hydrolysis, as suggested by in silico modeling

  • Reduction in V-ATPase activity, demonstrated by decreased LysoSensor fluorescence and reduced growth in varying CaCl₂ concentrations in yeast models

  • Alteration of hydrogen bonds with surrounding residues, affecting protein stability, as observed with the Ala22Thr mutation

  • Introduction of novel hydrogen bonds or chemical groups (like hydroxide radicals) that potentially influence proton transport in the hemichannel formed by the proteolipid c-ring and a-subunit

  • Protein destabilization, as predicted for some variants (e.g., Ala22Thr) that cause a decrease in protein stability with a negative DDG value

How do ATP6V0C variants affect neurological function in model organisms?

Studies in various model organisms have demonstrated how ATP6V0C variants impact neurological function:

  • In Drosophila, knockdown of ATP6V0C resulted in increased duration of seizure-like behavior

  • In Caenorhabditis elegans, expression of selected patient variants led to reduced growth, motor dysfunction, and reduced lifespan

  • In mammalian systems, disruption of V-ATPase function affects organelle acidification, which is critical for neurotransmitter loading into synaptic vesicles and proper neuronal function

These findings provide strong evidence for the pathogenicity of ATP6V0C variants and offer insights into the underlying disease mechanisms in human patients.

How can functional assays be optimized to assess the impact of specific ATP6V0C variants?

For optimized functional assessment of ATP6V0C variants, researchers should employ a multi-platform approach:

  • Yeast complementation assays: Using S. cerevisiae with the VMA3 gene (yeast homolog of ATP6V0C) deleted can provide a clean system to test human ATP6V0C variants. Growth curves in media with varying pH and calcium concentrations can quantitatively assess V-ATPase function

  • LysoSensor fluorescence assays: These provide direct measurement of organelle acidification capacity and should be standardized across cell types with appropriate controls

  • Electrophysiological measurements: In neuronal models expressing ATP6V0C variants, patch-clamp recordings can detect alterations in neuronal excitability that may explain seizure phenotypes

  • Protein stability and trafficking assays: Pulse-chase experiments combined with subcellular fractionation can determine if variants affect protein half-life or proper localization

  • C. elegans behavioral assays: Standardized protocols for assessing movement, lifespan, and stress responses provide quantifiable phenotypes that correlate with disease severity

What are the challenges in differentiating haploinsufficiency from dominant-negative effects of ATP6V0C variants?

Distinguishing between haploinsufficiency and dominant-negative mechanisms for ATP6V0C variants presents several research challenges:

  • Complex c-ring assembly: The c-ring contains multiple copies of ATP6V0C, making it difficult to determine whether a variant protein disrupts the entire complex (dominant-negative) or simply fails to contribute (haploinsufficiency)

  • mRNA analysis considerations: As observed with a stop-loss variant, mutant transcripts may escape nonsense-mediated decay (NMD), allowing expression of altered proteins that could exert dominant-negative effects despite decreased mRNA levels

  • Functional threshold effects: Different cellular functions of V-ATPase may have different sensitivity thresholds to reduced activity, complicating interpretation of partial loss-of-function phenotypes

  • Experimental approach recommendations:

    • Co-expression studies with wild-type and mutant proteins at different ratios

    • Single-cell analysis of V-ATPase function in heterozygous models

    • Structure-function analysis of assembled c-rings containing mixtures of wild-type and mutant subunits

    • Comparison of variants affecting different functional domains of the protein

How can ATP6V0C research inform therapeutic strategies for associated disorders?

ATP6V0C research provides several potential avenues for therapeutic development:

  • Pharmacological chaperones: For missense variants that affect protein stability (like those with negative DDG values), small molecules could be designed to stabilize the mutant protein structure

  • V-ATPase modulators: Compounds that enhance the activity of remaining functional V-ATPase complexes might compensate for partial loss of function in heterozygous patients

  • pH homeostasis targeting: Drugs that modulate intracellular or lysosomal pH through alternative mechanisms could bypass V-ATPase dysfunction

  • Gene therapy approaches: Given the small size of the ATP6V0C gene (three exons), it represents a feasible candidate for gene replacement therapy

  • Antisense oligonucleotides: For dominant-negative variants, reduction of mutant transcript levels could potentially restore V-ATPase function if haploinsufficiency is less detrimental than toxic gain-of-function

How conserved is ATP6V0C across species and what does this reveal about its function?

ATP6V0C demonstrates remarkable evolutionary conservation across species, highlighting its fundamental importance in cellular function. Amino acid sequence alignment reveals that certain residues, such as Ala22, are highly conserved across various species from yeast to humans . This conservation extends to both sequence and structural features:

  • The glutamate residue at position 139 (p.E139) is critical for proton translocation and is conserved across species

  • The four-transmembrane domain structure is maintained throughout evolution

  • Functional studies in diverse organisms (yeast, worms, flies, and mammals) show that ATP6V0C function in V-ATPase activity is conserved, as heterologous expression of human ATP6V0C can complement function in lower organisms

This high degree of conservation indicates strong evolutionary pressure to maintain ATP6V0C structure and function, consistent with its essential role in the fundamental cellular process of pH regulation and energy coupling.

What differences exist between recombinant rat ATP6V0C and its human ortholog?

While rat and human ATP6V0C share high sequence homology, researchers should be aware of subtle differences when using recombinant rat ATP6V0C as a model for human studies:

  • Sequence identity: Rat and human ATP6V0C proteins share approximately 96% amino acid identity, with most differences occurring in non-critical regions

  • Functional conservation: The key functional residues, including the glutamate essential for proton translocation, are identical between species

  • Research application considerations:

    • Antibodies raised against human ATP6V0C typically cross-react with rat ATP6V0C due to high sequence conservation

    • When designing site-directed mutagenesis experiments to model human pathogenic variants, researchers should confirm that the corresponding residue is conserved in rat ATP6V0C

    • Protein-protein interaction studies should account for potential species-specific differences in binding partners or regulatory proteins

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.