Recombinant Rat V-type proton ATPase subunit S1 (Atp6ap1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a useful reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
Atp6ap1; Atp6ip1; Atp6s1; V-type proton ATPase subunit S1; V-ATPase subunit S1; C7-1 protein; V-ATPase Ac45 subunit; V-ATPase S1 accessory protein; Vacuolar proton pump subunit S1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
33-463
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
VAAEQQVPLVLWSSDRDLWAPVADTHEGHITSDMQLSTYLDPALELGPRNVLLFLQDKLS IEDFTAYGGVFGNKQDSAFSNLENALDLAPSSLVLPAVDWYAISTLTTYLQEKLGASPLH VDLATLKELKLNASLPALLLIRLPYTASSGLMAPREVLTGNDEVIGQVLSTLESEDVPYT AALTAVRPSRVARDVAMVAGGLGRQLLQTQVASPAIHPPVSYNDTAPRILFWAQNFSVAY KDEWKDLTSLTFGVENLNLTGSFWNDSFAMLSLTYEPLFGATVTFKFILASRFYPVSARY WFTMERLEIHSNGSVAHFNVSQVTGPSIYSFHCEYVSSLSKKGSLLVTNVPSLWQMTLHN FQIQAFNVTGEQFSYASDCAGFFSPGIWMGLLTTLFMLFIFTYGLHMILSLKTMDRFDDR KGPTITLTQIV
Uniprot No.

Target Background

Function

Accessory subunit of the proton-transporting vacuolar (V)-ATPase protein pump, essential for luminal acidification of secretory vesicles. It guides the V-type ATPase to specialized subcellular compartments, such as neuroendocrine regulated secretory vesicles or the osteoclast ruffled border, thereby regulating its activity. It's involved in membrane trafficking and Ca2+-dependent membrane fusion and may play a role in V-type ATPase complex assembly. Under aerobic conditions, it participates in intracellular iron homeostasis, activating Fe2+ prolyl hydroxylase (PHD) enzymes, leading to HIF1A hydroxylation and subsequent proteasomal degradation.

Database Links
Protein Families
Vacuolar ATPase subunit S1 family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane.

Q&A

What is ATP6AP1 and what is its role in V-ATPase complexes?

ATP6AP1 (also known as Ac45) is a V-ATPase proton pump accessory subunit required for luminal acidification of secretory vesicles, Golgi apparatus, and lysosomes . It serves as a structural hub for V-ATPase assembly, connecting multiple V₀ subunits and phospholipids inside the c-ring . Unlike its yeast counterpart (V₀a1), mammalian ATP6AP1 contains not only a transmembrane (TM) helix but also a substantial luminal domain (LD) that folds as a globular β-prism structure . This architecture allows ATP6AP1 to function as a central player in V-ATPase biogenesis, stability, and function in mammalian systems.

What is the ATP:H⁺ ratio in V-ATPases containing ATP6AP1?

Based on cryo-electron microscopy (cryo-EM) studies of mammalian brain V-ATPase, the ATP:H⁺ ratio has been determined to be 3:10 . This means that for every 3 ATP molecules hydrolyzed, 10 protons are translocated across the membrane. This stoichiometry is crucial for understanding the energetics and efficiency of proton pumping by V-ATPases in physiological contexts.

What are the most effective methods for isolating homogeneous mammalian V-ATPase complexes containing ATP6AP1?

One particularly effective approach for isolating homogeneous mammalian V-ATPase complexes containing ATP6AP1 is through its interaction with SidK, a Legionella pneumophila effector protein . This method has been successfully used to isolate V-ATPase from rat brain for high-resolution structural studies. The general protocol involves:

  • Tissue homogenization and membrane isolation from rat brain

  • Solubilization of membrane proteins using appropriate detergents

  • Affinity chromatography using SidK as a bait protein

  • Size exclusion chromatography for further purification

  • Verification of complex integrity by SDS-PAGE and Western blotting

This approach yields highly homogeneous V-ATPase complexes suitable for structural and functional analyses by cryo-EM and other biophysical techniques .

What techniques are most suitable for studying ATP6AP1 interactions within the V-ATPase complex?

Several complementary techniques have proven effective for studying ATP6AP1 interactions:

  • Cryo-EM: High-resolution (2.9-3.9 Å) cryo-EM has been instrumental in revealing the detailed structure of ATP6AP1 within the V-ATPase complex, including its interactions with other subunits and lipids .

  • Mass Spectrometry: Used to verify protein subunit composition and identify post-translational modifications like N-linked glycans on ATP6AP1 .

  • Protein-Protein Interaction Analysis: The STRING database can be used to predict and analyze protein-protein interaction networks involving ATP6AP1 .

  • Co-immunoprecipitation: Effective for verifying specific interactions between ATP6AP1 and other V-ATPase subunits in native contexts.

  • Mutagenesis Studies: Site-directed mutagenesis of key residues in ATP6AP1 can help determine critical interaction sites with other V-ATPase components.

How is ATP6AP1 expression linked to cancer progression, particularly in breast cancer?

Research indicates that ATP6AP1 expression is significantly upregulated in breast cancer tissues compared to normal breast tissues . Patients with elevated ATP6AP1 expression have been found to have shorter survival rates than those with lower expression levels (p = 0.032) . The diagnostic value of ATP6AP1 expression in distinguishing breast cancer from normal tissues is supported by ROC analysis, which showed an area under the curve of 0.939 .

ATP6AP1 may contribute to breast cancer progression through multiple mechanisms:

  • Immunosuppression: Higher ATP6AP1 expression correlates with reduced immune infiltration, including decreased presence of macrophages, B cells, dendritic cells, cytotoxic cells, NK cells, and T cells .

  • Metabolic Alterations: Gene set enrichment analysis revealed that high ATP6AP1 expression is associated with enhanced iron uptake and transport, proteasome degradation, glutathione metabolism, and pyruvate metabolism pathways .

  • Microenvironment Acidification: As part of the V-ATPase system, ATP6AP1 helps maintain an acidic pH in the tumor microenvironment, which may facilitate tumor cell survival under hypoxic conditions .

These findings suggest that ATP6AP1 could serve as a potential biomarker for breast cancer diagnosis, prognosis, and as a therapeutic target.

What prognostic value does ATP6AP1 expression have in clinical settings?

ATP6AP1 expression levels have demonstrated significant prognostic value in breast cancer patients. A nomogram based on Cox regression analysis incorporating ATP6AP1 expression with other clinicopathological parameters has been developed to predict survival probability at 2, 4, and 6 years . This model showed robust performance in calibration plots, where actual and predicted survival probabilities were highly consistent.

ATP6AP1 expression was found to be significantly related to:

  • Patient age

  • Estrogen receptor (ER) status

  • Progesterone receptor (PR) status

The prognostic model was validated using ROC curves and decision curve analysis (DCA), confirming its value for predicting patient outcomes . This suggests that ATP6AP1 expression analysis could be integrated into clinical assessment to provide personalized prognostic information for breast cancer patients.

How does glycosylation of ATP6AP1 affect V-ATPase function and assembly?

ATP6AP1 contains N-linked glycans that form part of a luminal glycan coat . This glycosylation is functionally significant as:

  • The glycan coat appears critical for V-ATPase stability and function in the acidic luminal environment.

  • Structural studies have identified specific glycosylation sites on ATP6AP1 using high-resolution cryo-EM combined with mass spectrometry .

  • The positioning of these glycans suggests they may protect the luminal domains from the acidic environment and potentially mediate interactions with other luminal proteins.

  • Glycosylation may influence the folding and stability of the substantial luminal domain (LD) that distinguishes mammalian ATP6AP1 from its yeast counterpart.

Researchers investigating ATP6AP1 glycosylation should consider employing glycosidases, site-directed mutagenesis of glycosylation sites, and lectin-based affinity approaches to assess the functional consequences of altered glycosylation patterns.

What role does ATP6AP1 play in the regulation of V-ATPase rotational states?

V-ATPases function through a rotary mechanism where ATP hydrolysis drives the rotation of components to facilitate proton transfer. Human V-ATPase structures have been captured in three distinct rotational states at resolutions up to 2.9 Å . ATP6AP1 appears to influence these rotational states through:

  • Stabilization of specific interactions between the V₁ and V₀ complexes.

  • Interactions with phospholipids inside the c-ring, which may affect the rotational dynamics.

  • Connection to the central rotor components, potentially influencing the coupling between ATP hydrolysis and proton translocation.

What are the optimal expression systems for producing functional recombinant rat ATP6AP1?

For the production of functional recombinant rat ATP6AP1, several expression systems can be considered, each with specific advantages:

  • Mammalian Expression Systems: Cell lines like HEK293 or CHO cells are preferable for producing properly folded and glycosylated ATP6AP1, which is crucial given the importance of its glycan coat . These systems best recapitulate the native post-translational modifications.

  • Insect Cell Systems: Sf9 or High Five insect cells provide a good compromise between yield and proper protein folding, particularly for structural studies.

  • Co-expression Strategies: Given ATP6AP1's role in V-ATPase assembly, co-expression with interacting partners (particularly components of the V₀ complex) may improve stability and solubility.

  • Purification Considerations: Incorporating affinity tags (His, FLAG, etc.) at terminals less likely to interfere with function, followed by size exclusion chromatography in buffers containing appropriate detergents or lipid nanodiscs for the transmembrane region.

Expression constructs should be carefully designed based on the high-resolution structural information available , particularly considering the transmembrane helix and luminal domain organization.

What approaches are most effective for studying ATP6AP1's role in neuronal function?

Given ATP6AP1's importance in neuronal V-ATPases that facilitate neurotransmitter loading into synaptic vesicles , several specialized approaches are recommended:

  • Primary Neuronal Cultures: Utilizing rat primary neurons for studying physiological functions, combined with ATP6AP1 knockdown or overexpression using viral vectors.

  • Synaptic Vesicle Isolation: Purification of synaptic vesicles followed by proteomic and functional analysis to assess ATP6AP1's role in neurotransmitter loading.

  • Electrophysiology: Patch-clamp recordings to assess synaptic transmission in contexts where ATP6AP1 function is altered.

  • Real-time pH Measurements: Using pH-sensitive fluorescent probes to monitor V-ATPase-mediated acidification of synaptic vesicles in various ATP6AP1 expression or mutation scenarios.

  • Super-resolution Microscopy: Techniques like STORM or PALM to visualize the localization and dynamics of ATP6AP1 in neuronal compartments.

These approaches can be combined to provide comprehensive insights into how ATP6AP1 contributes to neuronal function through its role in V-ATPase assembly and activity.

What are emerging therapeutic approaches targeting ATP6AP1 in cancer?

Based on the association between ATP6AP1 overexpression and poor prognosis in breast cancer , several therapeutic approaches are being explored:

  • Small Molecule Inhibitors: Developing compounds that specifically disrupt ATP6AP1's interactions with other V-ATPase components could reduce V-ATPase activity in cancer cells.

  • Immunotherapy Enhancement: Since ATP6AP1 overexpression correlates with immunosuppression , combining ATP6AP1 inhibition with checkpoint inhibitors might improve anti-tumor immune responses.

  • Metabolic Targeting: Exploiting ATP6AP1's role in iron metabolism and pyruvate metabolism pathways to develop combination therapies that target cancer-specific metabolic vulnerabilities.

  • RNAi and Antisense Approaches: Reducing ATP6AP1 expression through siRNA, shRNA, or antisense oligonucleotides to impair V-ATPase assembly in cancer cells.

Research should focus on developing highly specific approaches that target cancer-specific aspects of ATP6AP1 function to minimize potential side effects on normal cellular processes.

How might structural differences between human and rat ATP6AP1 affect experimental design and interpretation?

While rat and human ATP6AP1 share significant homology, researchers should consider several key aspects when translating findings between species:

  • Sequence Variations: Amino acid differences may affect antibody recognition, protein-protein interactions, and drug binding sites.

  • Glycosylation Patterns: Potential differences in N-linked glycosylation sites could alter protein stability and interactions.

  • Tissue-Specific Expression: Expression levels and isoform distribution may vary between rat and human tissues.

  • Functional Conservation: While the core functions are likely conserved, subtle differences might exist in regulatory mechanisms or interaction partners.

When designing experiments with recombinant rat ATP6AP1 with the intention of translating findings to human systems, researchers should:

  • Perform sequence alignments to identify conserved and divergent regions

  • Validate key findings in both rat and human experimental systems when possible

  • Consider using humanized models for preclinical studies aimed at therapeutic development

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.