Recombinant Rat Vacuole membrane protein 1 (Vmp1)

Shipped with Ice Packs
In Stock

Description

Expression and Purification

Recombinant Vmp1 is produced via in vitro expression in E. coli, enabling high-yield purification for experimental use. Key steps include:

  • Cloning: The rat Vmp1 gene is cloned into expression vectors under inducible promoters .

  • Purification: Affinity chromatography using the His-tag ensures high purity .

  • Stability: Repeated freeze-thaw cycles are discouraged to prevent denaturation .

Autophagy Regulation

  • Vmp1 interacts with Beclin 1 via its C-terminal AtgD domain, displacing Bcl-2 to activate the Class III PI3K complex (Beclin 1-hVps34) for autophagosome formation .

  • Silencing Vmp1 in mammalian cells disrupts autophagosome maturation and LC3-I/II conversion .

ER Calcium Homeostasis

  • Vmp1 modulates ER calcium levels by regulating SERCA (sarcoendoplasmic reticulum calcium ATPase). Deficiency causes ER calcium overload, triggering ER stress and unfolded protein response (UPR) .

Lipid Metabolism

  • Vmp1 collaborates with TMEM41B as a lipid scramblase, facilitating phosphatidylserine and cholesterol distribution in ER membranes .

Disease Implications

  • Cancer: Low Vmp1 expression correlates with poor prognosis in breast and liver cancers. Overexpression inhibits tumor cell proliferation and metastasis by enhancing cell-cell adhesion proteins (e.g., E-cadherin) and suppressing PI3K/AKT signaling .

  • Pancreatitis: Vmp1 deficiency in pancreatic acinar cells exacerbates inflammation and fibrosis via impaired autophagy and NFE2L2/Nrf2 pathway dysregulation .

Research Applications

Recombinant Vmp1 is pivotal in:

  • Mechanistic Studies: Investigating autophagy initiation, ER-membrane contact sites, and viral replication (e.g., flaviviruses) .

  • Therapeutic Development: Targeting Vmp1 in cancer (via CRISPR or shRNA silencing) and pancreatitis models .

  • Protein Interaction Assays: FRET-based studies confirm Vmp1-Beclin 1 binding in vivo .

Key Experimental Findings

  • In Breast Cancer:

    • Silencing Vmp1 in MCF7 cells increases proliferation (48-hour MTT assay) and migration (transwell assay) via PI3K/AKT activation and ZO-1/E-cadherin downregulation .

  • In Autophagy:

    • Vmp1 knockout in Atg5−/− MEFs causes accumulation of enlarged autophagosomal membranes, confirming its upstream role in autophagosome formation .

Challenges and Limitations

  • Structural Complexity: Multi-spanning transmembrane topology complicates crystallization for structural studies .

  • Functional Redundancy: Partial overlap with TMEM41B in lipid scrambling complicates phenotype interpretation .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If a specific tag is required, please inform us for preferential development.
Synonyms
Vmp1; Vacuole membrane protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-406
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MAENGTNCDQRRGAMSKEQHNGSFTDPSSVNEKKRRDREERQNIVLWRQPLITLQYFSLE TLVVLKEWTSKLWHRQSMVVSFFLLLAALVATYYVEGAHQQYVQRIEKQFLLYAYWIGLG ILSSVGLGTGLHTFLLYLGPHIASVTLAAYECNSVNFPEPPYPDQIICPDEEGTEGAISL WSIISKVRIEACMWGIGTAIGELPPYFMARAARLSGAEPDDEEYQEFEEMLEHAETAQDF ASRAKLAVQKLVQKVGFFGILACASIPNPLFDLAGITCGHFLVPFWTFFGATLIGKAIIK MHIQKIFVIVTFSKHIVEQMVAFIGAVPGIGPSLQKPFQEYLEAQRQKLHHRSEAGTAQG ENWLSWTFEKLVVAMVCYFILSIINSMAQSYAKRIQQRLNSEEKTK
Uniprot No.

Target Background

Function
Vacuole membrane protein 1 (VMP1) is a phospholipid scramblase implicated in lipid homeostasis and membrane dynamics. It exhibits scramblase activity towards cholesterol, phosphatidylserine, phosphatidylethanolamine, and phosphatidylcholine. VMP1 is essential for autophagosome formation, participating in early biogenesis at the endoplasmic reticulum (ER) membrane by re-equilibrating ER leaflets during lipid extraction by ATG2 (ATG2A or ATG2B) for autophagosome assembly. It regulates ATP2A2 activity to control ER-isolation membrane contacts for autophagosome formation. Beyond autophagy, VMP1's phospholipid scramblase activity contributes to other processes, including modulation of ER contacts with lipid droplets, mitochondria, and endosomes. It plays a crucial role in cell junction formation. Under stress, such as bacterial or viral infection, VMP1 promotes cytoplasmic vacuole formation and subsequent cell death. It also participates in acinar cell vacuolization during early acute pancreatitis.
Gene References Into Functions
  1. Zymophagy, a novel selective autophagy pathway mediated by VMP1-USP9x-p62, prevents pancreatic cell death. PMID: 21173155
  2. VMP1 expression may be involved in the cytoplasmic vacuolization of acinar cells during the early stage of acute pancreatitis. PMID: 12649568
  3. Pancreatic beta cells trigger VMP1 expression and autophagy during the early cellular response to experimental diabetes. PMID: 19077458
Database Links
Protein Families
VMP1 family
Subcellular Location
Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Vacuole membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Highly expressed in intestine, kidney, ovary and placenta, moderately expressed in liver, lung, stomach, thymus, brain, and testis and slightly expressed in control thyroid and retina. Strongly expressed in pancreas (acinar cells) during acute pancreatiti

Q&A

What is the structural composition of Vmp1?

Vmp1 is a 406-amino acid transmembrane protein containing six hydrophobic regions that spans across the endoplasmic reticulum (ER) membrane. Both the N- and C-termini of Vmp1 are exposed to the cytosol, with the C-terminal region containing a putative ER retention signal. The N-terminal region includes a conserved sequence with potential to form an amphipathic alpha helix. The central portion contains an autophagy-related (ATG) domain critical for its function in the autophagy process . Vmp1's structure enables it to function at the interface between ER and other cellular compartments, positioning it as a key regulator of membrane dynamics and organelle communication .

Where is Vmp1 primarily localized in cells?

Vmp1 is predominantly localized to the endoplasmic reticulum (ER) and is considered an ER-resident protein. Immunofluorescence studies have confirmed that Vmp1 is closely associated with, but clearly distinct from, markers for ER exit sites, the ER-Golgi intermediate compartment, and Golgi apparatus . Recent research using high-resolution microscopy has revealed that Vmp1 is enriched in specific ER microdomains that form close contacts with diverse organelles including isolation membranes, mitochondria, lipid droplets, and endosomes . In Toxoplasma gondii, TgVMP1 has been observed in both ER and Golgi compartments, as demonstrated through co-localization studies with ER-GFP and GRASP-GFP markers .

What are the primary cellular functions of Vmp1?

Vmp1 serves multiple critical functions in cellular homeostasis. First, it acts as a key regulator of autophagy, where its expression can be induced by starvation and rapamycin treatment, triggering conversion of LC3-I to LC3-II and autophagosome formation . Second, Vmp1 plays an essential role in ER-membrane contact sites, modulating the physical interactions between the ER and other cellular compartments including isolation membranes, mitochondria, lipid droplets, and endosomes . Third, Vmp1 is crucial for lipoprotein secretion, facilitating the release of lipoproteins from the ER membrane into the ER lumen . Additionally, in apicomplexan parasites like Toxoplasma gondii, TgVMP1 is involved in the biogenesis and function of secretory organelles such as micronemes, rhoptries, and dense granules . These diverse functions position Vmp1 as a central regulator of membrane dynamics and cellular trafficking.

How does Vmp1 contribute to neuronal homeostasis?

Vmp1 plays a critical role in maintaining neuronal homeostasis, particularly in midbrain dopaminergic (mDAergic) neurons. Studies using conditional knockout mice (Vmp1 fl/fl/DAT CreERT2) have demonstrated that Vmp1 deficiency in mDAergic neurons leads to progressive motor deficits and profound neuronal loss in the substantia nigra pars compacta (SNc) . At the cellular level, Vmp1 deficiency results in high presynaptic accumulation of α-synuclein in enlarged terminals, impaired autophagic flux (evidenced by increased LC3 puncta and p62 aggregates), and multiple cellular abnormalities including large vacuolar-like structures, damaged mitochondria, swollen ER, and accumulation of ubiquitin-positive aggregates . These findings suggest that Vmp1's regulation of autophagy is essential for axonal homeostasis and neuronal survival, with implications for understanding neurodegenerative disorders.

How does Vmp1 function as a lipid scramblase in organelle biogenesis?

Vmp1 functions as a putative lipid scramblase that facilitates the bidirectional movement of phospholipids across membrane bilayers, which is essential for membrane biogenesis and remodeling. In Toxoplasma gondii, TgVMP1 depletion results in decreased lipid droplet numbers, mirroring the phenotype observed in ER lipid scramblase-deficient cells . As a member of the DedA superfamily, Vmp1 likely maintains membrane asymmetry and fluidity by translocating specific phospholipids between membrane leaflets, thus creating appropriate lipid environments for protein sorting and organelle formation. In secretory organelle biogenesis, TgVMP1's scramblase activity appears critical for rhoptry formation, as evidenced by the complete loss of rhoptries in TgVMP1-depleted parasites . The lipid scrambling activity of Vmp1 also facilitates lipoprotein assembly and secretion by enabling lipid redistribution necessary for particle formation in the ER lumen .

What are the molecular mechanisms connecting Vmp1 dysfunction to autophagic impairment?

The molecular mechanisms linking Vmp1 dysfunction to autophagic impairment involve several interconnected pathways. Vmp1 plays a critical role in the early stages of autophagosome formation by modulating the contacts between the ER and isolation membranes . When Vmp1 is depleted, these contacts are altered, disrupting the transfer of lipids necessary for autophagosome expansion. Additionally, Vmp1 deficiency leads to accumulation of LC3-positive structures and p62 aggregates, indicating blocked autophagosome maturation or impaired autophagosome-lysosome fusion . At the molecular level, Vmp1 likely interacts with other autophagy proteins including Beclin-1, a component of the class III PI3K complex essential for autophagosome nucleation. The disruption of these interactions in Vmp1-deficient cells prevents proper formation and maturation of autophagosomes, ultimately leading to inefficient clearance of protein aggregates and damaged organelles . This autophagic impairment has profound consequences for cellular homeostasis, particularly in non-dividing cells like neurons.

How do species-specific variations in Vmp1 impact its functional conservation across organisms?

Despite sequence variations, Vmp1 exhibits remarkable functional conservation across species. Studies with apicomplexan parasites demonstrate that both human VMP1 and P. falciparum VMP1 (PfVMP1) can localize to the ER of TgVMP1-depleted Toxoplasma gondii parasites and rescue the depleted phenotype . This cross-species complementation suggests conservation of core functional domains despite evolutionary divergence. The most conserved regions include the transmembrane domains and the autophagy-related domain, while the cytosolic loops show greater variability across species. In mammals, Vmp1 orthologs maintain high sequence similarity, with rat and human Vmp1 sharing approximately 90% amino acid identity. Functional studies across model organisms including yeast, Dictyostelium, and mammals indicate that while regulatory mechanisms may differ, Vmp1's core functions in autophagy, membrane contact sites, and lipid homeostasis are largely preserved . This conservation highlights Vmp1's fundamental importance in cellular physiology and suggests that findings from model organisms can provide valuable insights applicable to human disease contexts.

What is the relationship between Vmp1 and disease states such as neurodegeneration?

Vmp1 dysfunction has been implicated in various neurodegenerative conditions through its effects on protein aggregation, organelle function, and cellular homeostasis. In conditional knockout models, Vmp1 deficiency in midbrain dopaminergic neurons leads to a Parkinson's disease-like phenotype with progressive motor deficits, dopaminergic neuron loss, and accumulation of α-synuclein in presynaptic terminals . The mechanistic link involves impaired autophagy, as evidenced by p62 aggregate accumulation and disrupted autophagic flux in Vmp1-deficient neurons. These defects prevent effective clearance of protein aggregates and damaged organelles, accelerating neuronal dysfunction and death. Beyond Parkinson's disease, Vmp1's roles in ER-mitochondria contacts and lipid metabolism suggest potential involvement in other neurodegenerative conditions characterized by mitochondrial dysfunction and altered lipid homeostasis . Additionally, the accumulation of large vacuolar-like structures and swollen ER in Vmp1-deficient neurons indicates ER stress, which is a common feature across various neurodegenerative disorders including Alzheimer's and Huntington's diseases .

What are the optimal approaches for generating Vmp1 knockout models?

Creating effective Vmp1 knockout models requires careful consideration of the protein's essential nature and tissue-specific functions. For conditional knockout approaches, the Cre-loxP system has proven effective, as demonstrated in several studies. The generation of Vmp1 flox mice with loxP sites flanking critical exons (typically exons 3 and 4) enables tissue-specific deletion when crossed with appropriate Cre-expressing lines . For example, Vmp1 fl/fl/DAT CreERT2 mice allow tamoxifen-inducible deletion specifically in dopaminergic neurons , while Vmp1 flox/flox crossed with Villin-Cre mice produces intestinal epithelium-specific knockouts .

For genotyping, PCR-based strategies using primers that detect both wild-type and mutant alleles are recommended. Typical protocols involve forward and reverse primers that yield different product sizes for wild-type versus modified alleles (e.g., 445 bp for wild-type and 640 bp for gene trap alleles, or 266 bp for wild-type and 391 bp for floxed alleles) .

How can researchers effectively analyze Vmp1 localization and interactions?

Analyzing Vmp1 localization and interactions requires multiple complementary approaches. For localization studies, fluorescence microscopy using tagged Vmp1 constructs (such as Vmp1-GFP or Vmp1-HA) combined with markers for specific organelles is highly effective. Researchers have successfully used ER-retention signals (such as HDEL) fused to fluorescent proteins to confirm ER localization . Super-resolution microscopy techniques like Airyscan microscopy provide enhanced detail for examining Vmp1-positive puncta and their relationships with other organelles.

For studying dynamic interactions, live-cell imaging with dual-color fluorescence enables visualization of Vmp1 movements relative to other cellular structures. Proximity-based assays such as proximity ligation assay (PLA) or fluorescence resonance energy transfer (FRET) can quantify Vmp1 interactions with partner proteins. Biochemical approaches including co-immunoprecipitation followed by mass spectrometry have identified Vmp1-interacting proteins in various cellular contexts.

For functional studies, fluorescence recovery after photobleaching (FRAP) can assess Vmp1 mobility within membranes, while electron microscopy provides ultrastructural details of Vmp1-associated membranes. In parasites like Toxoplasma gondii, researchers have successfully combined conditional protein depletion systems (such as auxin-inducible degron technology) with organelle-specific markers to examine the consequences of Vmp1 loss on cellular structures .

What experimental designs best capture Vmp1's role in autophagy and lipid metabolism?

To effectively investigate Vmp1's role in autophagy, researchers should employ multi-parameter approaches combining genetic manipulation, pharmacological interventions, and quantitative readouts. Key experimental designs include:

  • Autophagy flux assays: Monitoring LC3-I to LC3-II conversion and p62 levels with and without lysosomal inhibitors (such as bafilomycin A1) in Vmp1-depleted versus control cells provides insights into whether Vmp1 affects autophagosome formation or maturation .

  • Starvation and stress responses: Comparing autophagy induction under nutrient deprivation or rapamycin treatment between Vmp1-depleted and control cells helps define Vmp1's position in autophagy signaling pathways .

  • Live-cell imaging of autophagic structures: Tracking the dynamics of fluorescently labeled autophagy proteins (LC3, ATG proteins) in real-time reveals how Vmp1 influences the kinetics of autophagosome formation and maturation.

For lipid metabolism studies, effective approaches include:

  • Lipid droplet quantification: Using fluorescent dyes (BODIPY, Nile Red) or immunostaining for lipid droplet proteins (PLIN family) to measure changes in lipid droplet number, size, and distribution in Vmp1-manipulated cells .

  • Lipoprotein secretion assays: Measuring apolipoprotein levels in culture media and cellular fractions to determine how Vmp1 affects lipoprotein assembly and secretion .

  • Membrane contact site analysis: Using split-GFP or high-resolution microscopy to quantify changes in ER-organelle contacts when Vmp1 is depleted or overexpressed .

These experimental designs should incorporate appropriate controls and be analyzed using quantitative methods to ensure reproducibility and statistical significance.

What are the critical considerations for producing and purifying recombinant Vmp1 for in vitro studies?

Producing and purifying recombinant Vmp1 presents significant challenges due to its multi-pass transmembrane nature, but several strategies can improve success rates:

  • Expression system selection: Mammalian expression systems (HEK293, CHO cells) are preferred for full-length Vmp1 to ensure proper folding and post-translational modifications. For soluble domains, bacterial systems may be sufficient.

  • Construct design: Incorporating affinity tags (His6, FLAG, GST) at either the N- or C-terminus facilitates purification, with TEV protease cleavage sites allowing tag removal. For structural studies, consider expressing individual domains rather than the complete protein.

  • Detergent optimization: Screening multiple detergents is crucial for Vmp1 solubilization. Mild detergents like DDM, LMNG, or CHAPS preserve protein function better than harsh detergents like SDS. Alternatively, amphipols or nanodiscs can stabilize Vmp1 in a native-like membrane environment.

  • Purification strategy: A multi-step approach combining affinity chromatography, size exclusion, and ion exchange yields the highest purity. For Vmp1, affinity purification using anti-HA or Ni-NTA (for His-tagged constructs) followed by gel filtration has proven effective.

  • Protein quality assessment: Analyze purified Vmp1 using multiple methods including SDS-PAGE, Western blotting, mass spectrometry, and circular dichroism to verify identity, purity, and folding.

  • Functional validation: Verify purified Vmp1 activity through lipid scramblase assays using fluorescent phospholipid analogs or reconstitution into liposomes to measure lipid translocation rates.

Researchers should be aware that yield and stability challenges are common with multi-pass membrane proteins like Vmp1, often necessitating optimization of buffer conditions, addition of stabilizing agents, and immediate use of freshly purified protein for functional assays.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.