Recombinant Rat Very long-chain acyl-CoA synthetase (Slc27a2)

Shipped with Ice Packs
In Stock

Description

Biochemical Overview of Recombinant Rat SLC27A2

Recombinant Rat Very long-chain acyl-CoA synthetase (Slc27a2) is an engineered form of the enzyme encoded by the SLC27A2 gene, designed for research applications. This enzyme belongs to the solute carrier family 27 (SLC27) and functions as a fatty acid transporter and acyl-CoA synthetase. It catalyzes the ATP-dependent activation of long-chain (C16-C20), very-long-chain (≥C22), and branched-chain fatty acids into their CoA derivatives, a critical step in lipid metabolism .

Key Biochemical Functions:

  • Substrate Specificity: Activates saturated, polyunsaturated, and branched-chain fatty acids (e.g., phytanic acid) .

  • Cellular Localization: Expressed in peroxisomes and endoplasmic reticulum, with catalytic domains facing the peroxisomal lumen .

  • Metabolic Roles:

    • Facilitates fatty acid import into cells .

    • Supplies acyl-CoA esters for β-oxidation, ether lipid synthesis, and sphingosine-1-phosphate production .

Recombinant Production and Characterization

Recombinant Rat SLC27A2 is produced in heterologous expression systems such as E. coli or HEK293 cells, often tagged for purification (e.g., His, GST) .

Expression Systems and Yields:

ParameterDetails
Host SystemsE. coli, HEK293, mammalian cells
Purification TagsHis, Avi, DDK, Myc
Molecular Weight~54.8 kDa (partial recombinant human ortholog)
ActivityATP-dependent ligase activity confirmed via radiometric assays

Enzymatic Reactions Catalyzed

Recombinant SLC27A2 mediates the following reactions :

ReactionEC Number
Arachidonate + ATP + CoA → Arachidonoyl-CoA + AMP + Diphosphate6.2.1.3
3α,7α,12α-Trihydroxy-5β-cholestan-26-oate + ATP + CoA → THCA-CoA + AMP + PPi6.2.1.7
Phytanic acid + ATP + CoA → Phytanoyl-CoA + AMP + Diphosphate6.2.1.3

Lipid Metabolism Studies

  • Peroxisomal Function: Recombinant SLC27A2 is critical for reactivating very-long-chain fatty acids (VLCFAs) post-import into peroxisomes via ABCD transporters .

  • Bile Acid Synthesis: Although in vitro studies show THCA activation, in vivo relevance in bile acid synthesis remains minimal .

Disease Models

  • Cancer Research: Overexpression inhibits renal cancer (ccRCC) cell proliferation and metastasis by suppressing CDK3-mediated epithelial-mesenchymal transition .

  • Hematological Tumors: Low SLC27A2 expression correlates with accelerated cell cycle progression and reduced apoptosis in diffuse large B-cell lymphoma .

Metabolic Disorders

  • Diabetes: Slc27a2 knockout mice exhibit near-normal fasting glucose levels despite obesity, implicating its role in glycemic regulation .

Challenges and Future Directions

  • Topological Conflicts: Discrepancies persist regarding cytosolic vs. luminal orientation of catalytic sites in peroxisomes .

  • Therapeutic Potential: Targeting SLC27A2-CDK3-EMT axis shows promise in metastatic renal cancer , while its inhibition may mitigate mucociliary dysfunction in chronic rhinosinusitis .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have specific tag type requirements, please inform us, and we will prioritize development of the specified tag.
Synonyms
Slc27a2; Acsvl1; Facvl1; Fatp2; Vlacs; Vlcs; Very long-chain acyl-CoA synthetase; VLACS; VLCS; Arachidonate--CoA ligase; Fatty acid transport protein 2; FATP-2; Fatty-acid-coenzyme A ligase, very long-chain 1; Long-chain-fatty-acid--CoA ligase; Phytanate--CoA ligase; Solute carrier family 27 member 2; THCA-CoA ligase; Very long-chain-fatty-acid-CoA ligase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-620
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MLPVLYTGLAGLLLLPLLLTCCCPYLLQDVRFFLQLANMARQVRSYRQRRPVRTILHVFL EQARKTPHKPFLLFRDETLTYAQVDRRSNQVARALHDHLGLRQGDCVALFMGNEPAYVWL WLGLLKLGCPMACLNYNIRAKSLLHCFQCCGAKVLLASPELHEAVEEVLPTLKKEGVSVF YVSRTSNTNGVDTVLDKVDGVSADPIPESWRSEVTFTTPAVYIYTSGTTGLPKAATINHH RLWYGTSLALRSGIKAHDVIYTTMPLYHSAALMIGLHGCIVVGATFALRSKFSASQFWDD CRKYNATVIQYIGELLRYLCNTPQKPNDRDHKVKIALGNGLRGDVWREFIKRFGDIHIYE FYASTEGNIGFMNYPRKIGAVGRENYLQKKVVRHELIKYDVEKDEPVRDANGYCIKVPKG EVGLLICKITELTPFFGYAGGKTQTEKKKLRDVFKKGDVYFNSGDLLMIDRENFIYFHDR VGDTFRWKGENVATTEVADIVGLVDFVEEVNVYGVPVPGHEGRIGMASIKMKENYEFNGK KLFQHISEYLPSYSRPRFLRIQDTIEITGTFKHRKVTLMEEGFNPSVIKDTLYFMDDTEK TYVPMTEDIYNAIIDKTLKL
Uniprot No.

Target Background

Function
Very long-chain acyl-CoA synthetase (Slc27a2) is an acyl-CoA synthetase responsible for activating long-chain and very long-chain fatty acids (VLCFAs) by catalyzing the formation of fatty acyl-CoA. It can also activate branched-chain fatty acids such as phytanic acid and pristanic acid. This enzyme does not activate C24 bile acids like cholate and chenodeoxycholate. In vitro, it activates 3-alpha,7-alpha,12-alpha-trihydroxy- 5-beta-cholestanate (THCA), the C27 precursor of cholic acid derived from de novo synthesis from cholesterol. Slc27a2 exhibits long-chain fatty acids (LCFA) transport activity and plays a crucial role in hepatic fatty acid uptake.
Gene References Into Functions
  1. The progressive overexpression of slc27a2 in peripheral blood mononuclear cells of cafeteria-fed rats as body weight increases suggests this gene as an early marker of overweight development related to the intake of a hyperlipidic diet. PMID: 20142826
  2. In response to an increase of cellular cholesterol, fatty acid transporter is translocated from cytosol to membranes of type II pneumocytes. PMID: 12009898
Database Links

KEGG: rno:65192

UniGene: Rn.3608

Protein Families
ATP-dependent AMP-binding enzyme family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Peroxisome membrane; Peripheral membrane protein. Cell membrane; Multi-pass membrane protein. Microsome.
Tissue Specificity
Liver and kidney (at protein level).

Q&A

What is Rat Very Long-Chain Acyl-CoA Synthetase (Slc27a2)?

Rat Slc27a2 (also known as FATP2, VLCS, ACSVL1, or FACVL1) is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. This protein plays a critical role in lipid biosynthesis and fatty acid degradation by converting free long-chain fatty acids into fatty acyl-CoA esters. It specifically activates long-chain, branched-chain, and very-long-chain fatty acids containing 22 or more carbons to their CoA derivatives. Slc27a2 is part of the solute carrier family 27, which functions in fatty acid transport and metabolism .

What is the tissue distribution of Rat Slc27a2?

Rat Slc27a2 is expressed predominantly in the liver and kidney. Unlike some other ACSL family members that show significant expression in brain tissue (such as ACSL3 and ACSL6), Slc27a2 has a more restricted expression pattern. Understanding this tissue-specific distribution is important when designing experiments to study its physiological role in fatty acid metabolism within specific organ systems .

What is the subcellular localization of Rat Slc27a2?

Rat Slc27a2 demonstrates a distinctive subcellular distribution pattern, being present in both the endoplasmic reticulum and peroxisomes but notably absent from mitochondria. This localization pattern distinguishes it from other ACSL family members, such as ACSL5, which has been identified on mitochondria. The dual localization suggests that Slc27a2 may participate in compartment-specific lipid metabolism pathways within the cell .

What expression systems are recommended for producing recombinant Rat Slc27a2?

Based on current research protocols, several expression systems have been successful for producing recombinant Rat Slc27a2. While E. coli systems have been used for some ACSL isoforms, mammalian expression systems like HEK293T cells often produce more properly folded and post-translationally modified protein. For optimal activity, consider the following expression parameters:

Expression SystemAdvantagesConsiderations
E. coliHigh yield, cost-effectiveMay lack proper folding and PTMs
HEK293TProper mammalian folding and PTMsLower yield, higher cost
Mammalian cellsPhysiologically relevant modificationsComplex purification process

When expressing in mammalian systems, inclusion of tags such as His, Flag, or Myc can facilitate purification while maintaining protein activity. Affinity purification using these tags followed by conventional chromatography steps has been demonstrated to yield functional protein with good purity (>80%) .

What are the optimal storage and handling conditions for recombinant Rat Slc27a2?

For maximum stability and retention of enzymatic activity, recombinant Rat Slc27a2 should be stored at -80°C in a buffer containing stabilizing agents. Based on protocols used for similar proteins, the following conditions are recommended:

  • Storage buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, with 10% glycerol as a cryoprotectant

  • Avoid repeated freeze-thaw cycles, which can significantly reduce activity

  • For cell culture applications, filter the protein solution before use (note that some protein loss may occur during filtration)

  • When properly stored, the recombinant protein should remain stable for approximately 12 months

How does the substrate specificity of Rat Slc27a2 compare to other ACSL isoforms?

Rat Slc27a2 shows distinctive substrate preferences compared to other ACSL family members. When comparing the kinetic parameters across ACSL isoforms, several important differences emerge:

SubstrateSlc27a2 characteristicsComparison to other isoforms
CoASimilar Km values to ACSL3/ACSL6Comparable affinity across isoforms
PalmitateSimilar Km values to ACSL3/ACSL6Comparable affinity across isoforms
Oleate4-6× lower Km values than ACSL4Higher affinity than brain ACSL4
ArachidonateSimilar Km values to ACSL3/ACSL6Lower preference than ACSL4
Polyunsaturated FAsModerate competition with palmitateStrong competition only with ACSL4

These substrate preference differences suggest that Slc27a2 may have evolved specialized functions in processing specific fatty acid types. In direct competition assays with palmitate, polyunsaturated fatty acids showed only moderate competition with Slc27a2 compared to the strong competitive effect observed with ACSL4 .

What are the key kinetic parameters for Rat Slc27a2 enzymatic activity?

Understanding the kinetic parameters of Rat Slc27a2 is essential for designing experiments to study its activity. Based on comparative studies with other ACSL isoforms, Slc27a2 demonstrates distinctive kinetic properties for various substrates:

  • For ATP: Shows intermediate affinity compared to splice variants of ACSL6

  • For CoA: Demonstrates similar affinity to ACSL3 and ACSL6 variants

  • For fatty acid substrates: Exhibits lower apparent Km values for oleate compared to ACSL4, indicating higher affinity

  • Temperature sensitivity: More resistant to heat inactivation compared to ACSL4

These parameters should be considered when designing in vitro activity assays to ensure optimal conditions for measuring Slc27a2 function .

How does recombinant Rat Slc27a2 respond to known ACSL inhibitors?

The response profile of Rat Slc27a2 to known inhibitors provides valuable tools for selective modulation in research settings. Experimental data reveals distinctive inhibition patterns:

InhibitorEffect on Slc27a2Effect on other ACSLsResearch application
Triacsin CNo significant inhibitionInhibits ACSL1 and ACSL4Can be used to distinguish Slc27a2 activity
RosiglitazoneNo significant inhibitionInhibits ACSL4Useful for differential ACSL activity studies

This inhibitor profile is particularly valuable for distinguishing the specific contribution of Slc27a2 from other ACSL isoforms in mixed systems. When designing experiments using these inhibitors, it's important to include appropriate controls to verify the selectivity in your specific experimental conditions .

What experimental approaches are recommended for studying Slc27a2 function in cellular fatty acid metabolism?

To investigate the role of Slc27a2 in cellular fatty acid metabolism, several complementary approaches can be employed:

  • Overexpression studies: Adenoviral-mediated or plasmid-based overexpression of Slc27a2 in relevant cell lines (hepatocytes or kidney cells) can reveal its impact on fatty acid uptake and metabolism.

  • Metabolic flux analysis: Incubating cells with radiolabeled fatty acids (e.g., [1-14C]oleic acid) allows tracking of fatty acid fate through various metabolic pathways. Similar approaches with [1-14C]acetic acid can distinguish effects on de novo synthesized versus exogenous fatty acids.

  • Subcellular fractionation: Separating cellular compartments can reveal the distribution of Slc27a2 activity across organelles and help understand its compartment-specific roles.

  • Knockout/knockdown approaches: CRISPR-Cas9 or siRNA techniques can be used to reduce Slc27a2 expression and evaluate the resulting metabolic consequences.

When using overexpression approaches, confocal microscopy is recommended to confirm the subcellular localization of the expressed protein, as this can significantly impact the interpretation of metabolic results .

What is the relevance of Slc27a2 in kidney disease models?

Recent research has uncovered significant connections between Slc27a2 expression and kidney function. Analysis of human kidney biopsy samples through Nephroseq revealed that chronic kidney disease (CKD) patients with eGFR less than 60 ml/min show significantly reduced SLC27A2 mRNA levels compared to healthy controls with eGFR above 90 ml/min. Furthermore, a positive correlation exists between tubular SLC27A2 expression and eGFR values (r² = 0.0629, p = 0.0006), suggesting a potential role in kidney function maintenance.

When designing experiments to investigate Slc27a2 in kidney disease, researchers should consider:

  • Using both in vitro models (such as HK-2 cells) and in vivo kidney disease models

  • Measuring both mRNA and protein expression, as these may not always correlate

  • Evaluating the impact of Slc27a2 manipulation on tubular lipid metabolism

  • Considering species differences, as expression patterns may vary between humans and rodent models

How is Slc27a2 involved in peroxisomal disorders?

Slc27a2's role in peroxisomal fatty acid metabolism makes it particularly relevant to peroxisomal disorders. Decreased peroxisomal enzyme activity of Slc27a2 has been implicated in the biochemical pathology of X-linked adrenoleukodystrophy, a severe neurodegenerative disease characterized by the accumulation of very long-chain fatty acids.

When studying Slc27a2 in the context of peroxisomal disorders, researchers should:

How can researchers address the challenge of distinguishing Slc27a2 activity from other ACSL isoforms?

Distinguishing the specific activity of Slc27a2 from other ACSL isoforms presents a significant challenge in research settings. To address this, consider the following methodological approaches:

  • Selective inhibition: Utilize the differential sensitivity to inhibitors - Slc27a2 is resistant to triacsin C and rosiglitazone, which inhibit ACSL1/4 and ACSL4, respectively.

  • Substrate competition assays: Design competition assays using the characteristic substrate preferences of Slc27a2 compared to other isoforms.

  • Subcellular fractionation: Isolate peroxisomes and endoplasmic reticulum, where Slc27a2 is predominantly located, separated from mitochondria.

  • Isoform-specific antibodies: Employ highly specific antibodies that can distinguish between closely related ACSL isoforms for immunoprecipitation or immunoblotting.

  • Recombinant expression systems: Express individual isoforms in systems with low endogenous ACSL activity to characterize their individual properties .

What are the critical considerations for measuring enzyme activity of recombinant Rat Slc27a2?

Accurate measurement of Slc27a2 enzymatic activity requires careful attention to several experimental parameters:

  • Assay buffer composition: The optimal buffer should contain:

    • 175 mM Tris-HCl (pH 7.4)

    • 8 mM MgCl₂

    • 5 mM DTT

    • 10 mM ATP

    • 0.25 mM CoA

    • Appropriate fatty acid substrate (e.g., palmitate)

  • Detergent considerations: Since Slc27a2 is membrane-associated, mild detergents may be necessary for activity assays, but excessive detergent can disrupt enzyme function.

  • Temperature sensitivity: While Slc27a2 is more resistant to heat inactivation than some ACSL isoforms, activity assays should be performed at consistent temperatures, typically 37°C.

  • Detection methods: Multiple methods can be employed:

    • Radiometric assays using [¹⁴C]-labeled fatty acids

    • HPLC-based detection of acyl-CoA formation

    • Coupled enzyme assays measuring AMP production

  • Substrate presentation: Due to the hydrophobic nature of fatty acid substrates, proper solubilization (using albumin carriers or appropriate detergents) is critical for accurate activity measurements .

What emerging technologies might enhance our understanding of Rat Slc27a2 function?

Several cutting-edge technologies hold promise for advancing our understanding of Slc27a2 function:

  • Cryo-electron microscopy: Could reveal the detailed three-dimensional structure of Slc27a2, providing insights into substrate binding mechanisms and conformational changes during catalysis.

  • CRISPR-Cas9 genome editing: Enables precise modification of the Slc27a2 gene to study specific domains or create tissue-specific conditional knockout models.

  • Lipidomics approaches: High-resolution mass spectrometry can provide comprehensive profiles of lipid species affected by Slc27a2 manipulation.

  • Single-cell technologies: RNA-seq and proteomics at the single-cell level can reveal cell-type-specific roles of Slc27a2 within heterogeneous tissues.

  • Organoid models: Three-dimensional tissue culture systems that better recapitulate in vivo conditions for studying Slc27a2 function in liver or kidney contexts.

These technologies could address existing knowledge gaps regarding structure-function relationships, tissue-specific roles, and the impact of Slc27a2 on the broader lipidome .

How might targeted manipulation of Slc27a2 be exploited in metabolic disease research?

The strategic manipulation of Slc27a2 presents several opportunities for metabolic disease research:

  • Therapeutic targeting: Given its role in fatty acid metabolism and its association with kidney function, Slc27a2 modulation could be explored as a therapeutic approach for conditions characterized by lipid dysregulation.

  • Biomarker development: The correlation between Slc27a2 expression and kidney function suggests potential utility as a biomarker for disease progression or treatment response.

  • Metabolic reprogramming: Controlled manipulation of Slc27a2 could be used to redirect cellular fatty acid metabolism, potentially ameliorating lipotoxicity in disease states.

  • Organ-specific interventions: The restricted tissue expression pattern of Slc27a2 may allow for organ-targeted approaches with fewer systemic effects.

  • Combined interventions: Synergistic approaches targeting Slc27a2 alongside other fatty acid metabolism enzymes could provide more comprehensive metabolic modulation.

When designing such studies, researchers should consider the potential compensatory mechanisms by other ACSL family members and the broader metabolic consequences of Slc27a2 manipulation .

What strategies can address low activity of recombinant Rat Slc27a2?

When confronted with low enzymatic activity of recombinant Slc27a2, researchers should systematically explore the following troubleshooting approaches:

  • Expression system optimization:

    • Consider switching from bacterial to mammalian expression systems

    • Evaluate the impact of different tags on protein folding and activity

    • Optimize codon usage for the expression system

  • Purification protocol refinement:

    • Use gentle elution conditions to prevent denaturation

    • Include stabilizing agents (glycerol, reducing agents) in all buffers

    • Minimize time at room temperature during purification

  • Storage condition evaluation:

    • Test stability at different storage temperatures

    • Evaluate the impact of different cryoprotectants

    • Aliquot protein to avoid repeated freeze-thaw cycles

  • Activity assay optimization:

    • Verify substrate quality and solubilization

    • Test different buffer compositions and pH values

    • Ensure adequate cofactor concentrations (ATP, CoA, Mg²⁺)

  • Protein quality assessment:

    • Confirm proper folding using circular dichroism

    • Verify oligomeric state using size exclusion chromatography

    • Check for post-translational modifications that might affect activity

These approaches should be systematically tested to identify the specific factors limiting Slc27a2 activity in your experimental system.

How do the splice variants of rat ACSL isoforms compare in functional properties?

The functional diversity among ACSL splice variants provides important insights into structure-function relationships within this enzyme family. Comparative analysis reveals:

ParameterACSL6_v1ACSL6_v2ACSL3Slc27a2 (ACSL)Significance
ATP Km8× higherLowerIntermediateIntermediateSuggests differential energy coupling
Thermal stabilityHighHighHighHighMore resistant than ACSL4
Oleate KmLowLowLowSimilar to v1/v24-6× lower than ACSL4
DHA preferenceModerateStrongModerateModerateVariant-specific substrate preferences
Inhibitor sensitivityResistant to triacsin CResistant to triacsin CInhibited by triacsin CSimilar to ACSL3Pharmacological differentiator

The differences between ACSL6_v1 and ACSL6_v2, which represent splice variants including exon 13 or 14 respectively, are particularly noteworthy. These variants show significant differences in ATP affinity and DHA preference despite high sequence similarity, demonstrating how alternative splicing creates functional diversity within the ACSL family .

This comparative analysis provides valuable insights for researchers seeking to understand the specific contributions of different ACSL isoforms to cellular fatty acid metabolism.

How does Slc27a2 contribute to broader lipid metabolic networks?

Slc27a2 functions as a key node in complex lipid metabolic networks, with connections to multiple pathways beyond simple fatty acid activation. Its strategic position allows it to influence:

  • Alpha-oxidation of phytanate: Slc27a2 participates in this specialized pathway for breaking down branched-chain fatty acids that cannot undergo conventional beta-oxidation.

  • Bile acid and bile salt metabolism: The enzyme contributes to pathways involved in the synthesis and modification of bile acids, which are critical for lipid digestion and cholesterol homeostasis.

  • Insulin resistance pathways: Slc27a2 has connections to metabolic pathways implicated in insulin resistance, suggesting a potential role in metabolic disorders.

  • Peroxisomal fatty acid oxidation: Its peroxisomal localization positions Slc27a2 to channel very long-chain fatty acids toward this organelle-specific oxidation pathway.

  • Lipid trafficking between organelles: The dual localization to ER and peroxisomes suggests a potential role in directing fatty acids between these compartments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.