Recombinant Rat Vesicle-associated membrane protein 2 (Vamp2)

Shipped with Ice Packs
In Stock

Description

Definition and Overview of Recombinant Rat Vesicle-associated Membrane Protein 2 (VAMP2)

Recombinant Rat VAMP2 refers to a bioengineered version of the vesicle-associated membrane protein 2, produced via bacterial expression systems (e.g., E. coli) and purified for research purposes. It is a critical component of the soluble N-ethylmaleimide-sensitive factor attachment protein receptor (SNARE) complex, essential for synaptic vesicle fusion and neurotransmitter release .

Domain-Specific Functions:

DomainRoleSupporting Evidence
JMDBinds acidic phospholipids, stabilizes SNARE complexMutations in JMD inhibit insulin secretion ; Trp residues penetrate lipid bilayers
TMDRegulates fusion pore opening; interacts with syntaxin-1A TMDDeletion reduces SNARE complex stability
C-TerminalForms force-generating α-helix bundle for membrane fusionCrystallography shows helix extension to TMDs

Membrane Fusion Studies

VAMP2 is pivotal in reconstituting SNARE-mediated membrane fusion in vitro and in vivo:

  • SNARE Complex Assembly: Forms stable complexes with syntaxin-1A and SNAP-25 to induce fusion pore formation .

  • Electrostatic Interactions: JMD binds negatively charged phospholipids (e.g., PS, PIP₂), enhancing fusion efficiency . Mutations reducing JMD charge (e.g., K85E/R86D) inhibit insulin granule secretion .

  • TMD Flexibility: Glycine 100 in TMD introduces structural kinks, enabling conformational changes during fusion .

Disease Models and Clinical Relevance

ConditionVAMP2 RoleSource
Neurodevelopmental DisordersHeterozygous mutations linked to hypotonia, autism, and hyperkinetic movements
EpilepsyImpaired synaptic transmission due to VAMP2 dysfunction
DiabetesRequired for insulin granule exocytosis in β-cells

Protein Interactions

Partner ProteinInteraction TypeFunctional ImpactSource
Syntaxin-1ASNARE complex formationAnchors VAMP2 to presynaptic membrane
SNAP-25SNARE complex assemblyStabilizes helix bundle for fusion
SynaptophysinVesicle clusteringModulates vesicle docking and fusion
α-SynucleinFusion pore regulationInhibits SNARE complex disassembly

Production and Purification Protocols

StepDetailsSource
ExpressionInduced in E. coli; partial variants include aa 2–94
PurificationNi-NTA affinity chromatography (His-tag)
Quality ControlSDS-PAGE (>85% purity); endotoxin levels untested
Storage-20°C (short-term), -80°C (long-term); avoid freeze-thaw cycles

Challenges and Controversies

  1. TMD Function: Debate persists on whether TMD directly drives fusion or stabilizes the SNARE complex .

  2. JMD-Lipid Interactions: Conflicting models exist on whether electrostatic or hydrophobic forces dominate JMD-membrane binding .

  3. Full-Length vs. Partial VAMP2: Full-length variants better mimic native function but are harder to produce .

Future Directions

  • Therapeutic Targets: Explore VAMP2 modulators for neurodevelopmental disorders .

  • Membrane Fusion Models: Use recombinant VAMP2 to study lipid-protein interactions in reconstituted systems .

  • Structural Studies: Resolve conformational dynamics of TMD and JMD during fusion .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request based on availability.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributors for specific delivery information.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to concentrate the contents. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be decided during production. If you have a preferred tag type, please inform us, and we will prioritize its development.
Synonyms
Vamp2; Syb2; Vesicle-associated membrane protein 2; VAMP-2; Synaptobrevin-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-116
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
SATAATVPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST
Uniprot No.

Target Background

Function
Vesicle-associated membrane protein 2 (Vamp2) plays a crucial role in the targeting and fusion of transport vesicles to their designated membrane. As a major SNARE protein in synaptic vesicles, it facilitates the fusion process required for the release of neurotransmitters. Vamp2 is essential for rapid vesicular exocytosis, activity-dependent neurotransmitter release, and the rapid endocytosis involved in the recycling of synaptic vesicles. Additionally, it modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1.
Gene References Into Functions
  1. Our findings reveal a close relationship between the dynamics of the VAMP2 transmembrane domains (mediated by the central glycine) and the fluidity of the lipid membrane. This interaction significantly influences the likelihood and speed of fusion pore opening and expansion. PMID: 28588281
  2. The ternary complex of syntaxin1:SNAP25:Munc18-1 binds synaptobrevin with fast kinetics, leading to the rapid formation of a fully zippered SNARE complex. Munc18-1 remains attached to this complex via the N-terminal domain of syntaxin1. PMID: 28483813
  3. Syp1 removes Syb2 from the presynaptic active zone, preventing short-term depression. PMID: 26854222
  4. These effects weaken the integrity of the outer membrane layer, primarily attributed to the highly charged linker and juxtamembrane regions of sybII PMID: 26851777
  5. miR-206 regulates lung surfactant secretion by limiting the availability of VAMP-2 protein. PMID: 25481410
  6. The distribution of SNAP25, VAMP1, and VAMP2 in adult deep cerebellar nuclei differs significantly from that observed in newborn DCN. Administration of E2 in newborn DCN affects synaptic density and alters their distribution. PMID: 24534378
  7. A novel interaction between SERT and a synaptic vesicle protein has been identified. PMID: 24878716
  8. In vivo silencing of VAMP2, but not VAMP3, in TALs blunts cAMP-stimulated steady-state surface NKCC2 expression and completely inhibits cAMP-stimulated NKCC2 exocytic delivery. PMID: 25008321
  9. Our findings suggest that VAMP-2 is the v-SNARE (vesicle SNARE) involved in regulated surfactant secretion. PMID: 22571236
  10. The Ca2+-dependent transition in syntaxin 1A (Syx) involves zippering between the membrane-proximal juxtamembrane regions of Syx and VAMP2. PMID: 23641074
  11. Blocking synaptobrevin inhibits endocytosis induced by boiled tetanus toxin. PMID: 23643538
  12. SNAP23-VAMP2 interaction plays a pivotal role in cAMP-mediated exocytosis from parotid glands. PMID: 23380067
  13. Amyloid-beta acts as a regulator of neurotransmitter release by disrupting the interaction between synaptophysin and VAMP2. PMID: 22905234
  14. A mechanism has been proposed where fusion pore formation is initiated by movement of the charged syb2 C-terminus within the membrane in response to pulling and tilting forces. PMID: 23009845
  15. VAMP2, SNAP25b, and syntaxin 1 are characteristic of most cerebellar glutamatergic synapses and only one type of GABAergic synapse. PMID: 22094010
  16. Dysregulation of the SNARE complex and syt-1 in the prefrontal cortex of adult-onset hypothyroidism can be restored by T(4) treatment. PMID: 21646859
  17. Munc18-1 and the neuronal SNAREs (t-SNARE (syntaxin 1.SNAP-25) and v-/t-SNARE (VAMP2.syntaxin 1.SNAP-25) complexes) possess an inherent capability to function as a fundamental stage-specific off/on switch for regulating membrane fusion. PMID: 21730064
  18. Data indicate that most of the synaptobrevin SNARE motif exhibits a notable reluctance to bind membranes. PMID: 21768342
  19. Synaptophysin and synaptobrevin 2 demonstrate dynamic expression during the development of the rat cochlea. PMID: 21556117
  20. Data reveal that complexin 2 interacts with vesicle-associated membrane protein (VAMP) 2, syntaxins 3 and 4. PMID: 20829354
  21. In the incisor dental pulp, all nerve fibers exhibit immunoreactivity for syntaxin-1, synaptosomal-associated protein (SNAP)-25, and vesicle-associated membrane protein (VAMP)-2. PMID: 20186959
  22. The ability of sybII to support exocytosis is inhibited by the addition of one or two residues to the sybII C terminus, depending on their energy of transfer from water to the membrane interface, following a Boltzmann distribution. PMID: 20937897
  23. Tomosyn positively regulates synaptic vesicle fusion by acting as a placeholder for VAMP2. PMID: 20633536
  24. Recombinant VAMP2 can serve as a replacement for VAMP2 synthetic peptide, potentially useful in endopeptidase assays as an alternative to the current mouse bioassay for detecting clostridial neurotoxins contaminating biotherapeutic products. PMID: 20005125
  25. Synaptobrevin 2 forms complexes with the plasma membrane-bound SNAREs syntaxin 1A and SNAP25 to initiate the fusion reaction. PMID: 12177041
  26. Data suggest that synaptophysin I has multiple roles in neurotransmitter release, regulating VAMP2 availability for the soluble N-ethylmaleimide-sensitive factor attachment protein receptor complex and participating in the late steps of exocytosis. PMID: 12181340
  27. VAMP2 mRNA levels increase during nerve regeneration of the facial motor nucleus after axotomy. PMID: 12191731
  28. Dimerization of synaptobrevin 2 in membranes is very weak, raising questions about its functional role in vivo. PMID: 12501216
  29. Vesicle-associated membrane protein 2 is involved in the secretion of polypeptides from the choroid plexus epithelium. PMID: 12559091
  30. The cytoplasmic domain of VAMP2 is essential for both the formation of VAMP2-SypI hetero-dimers and for VAMP2 sorting to SVs. PMID: 14528015
  31. Synaptobrevin-2 is present in approximately 35% of the taste cells in rat circumvallate taste buds and colocalizes with SNAP-25, serotonin, protein gene product 9.5, and type III inositol 1,4,5-triphosphate receptor. PMID: 14983476
  32. Homodimerization of Vamp2 is mediated by its transmembrane segment. PMID: 15109254
  33. Data suggest that VAMP2-dependent exocytosis regulates plasma membrane insertion of TRPC3 channels and contributes to carbachol-stimulation of Ca2+ influx. PMID: 15327778
  34. cAMP increases NKCC2 surface expression via a mechanism involving VAMP. NKCC2 trafficking to the apical membrane is involved in the stimulation of Tkidney medulla NaCl absorption by cAMP. PMID: 16144963
  35. VAMP 2 is the most abundant isoform in the rat brain and has widespread distribution. PMID: 16169186
  36. In astrocytes, a subpopulation of vesicles (labeled with a synaptobrevin2-EGFP chimera) exhibits high mobility and can fuse with the plasma membrane, at the level of the astrocyte processes, in a Ca2+-dependent manner. PMID: 16322057
  37. Results demonstrate that SNARE nucleation is confined to the N-terminal portion; zippering proceeds in an N- to C-terminal direction; synaptobrevin binds rapidly to the syntaxin/SNAP-25 acceptor; stabilizing the syntaxin/SNAP-25 acceptor by a peptide enabled fast liposome fusion. PMID: 16888141
  38. Individual pancreatic acinar cells express VAMP 2-specific populations of zymogen granules that orchestrate the constitutive and calcium(2+)-regulated secretory pathways. PMID: 17272274
  39. VAMP2 is expressed in muscle satellite cells and is upregulated during muscle regeneration. PMID: 17468895
  40. Cleavage of synaptobrevin 2 by tetanus toxin, known to reduce neurotransmission, did not affect the respiratory response to K+, while the general excitability of d PC12 cells increased. PMID: 18086678
  41. An analysis of SNARE mutations that cause a decrease in the ability of botulinum toxin-resistant synaptobrevin 2 to rescue regulated exocytosis in toxin-treated neuroendocrine cells was performed. PMID: 18508917
  42. An analysis of the substrate recognition mechanism of VAMP/synaptobrevin-cleaving clostridial neurotoxins was conducted. PMID: 18511418
  43. VAMP2 may contribute to the activity dependence of dense-core vesicles release. PMID: 18542995
  44. Findings suggest the involvement of VAMP2 in the development of skeletal muscles of somitic and non-somitic origins. PMID: 18570252
  45. Results show that synaptophysin-containing cells co-express vesicular-associated membrane protein 2 and cholecystokinin. PMID: 19253017
  46. 30 mW/cm(2) (SAR 14.1 W/kg) microwave radiation can result in the perturbation of synaptic vesicles associated proteins: synapsin I, synaptophysin, VAMP-2, and syntaxin. PMID: 19603498
  47. VAMP2, VAMP5, and VAMP7 may be involved in the translocation of GLUT4 during muscle contractions. PMID: 19675279
  48. Data suggest that VAMP2 modulates Kv2.1 inactivation by interfering with the interaction between the docking loop and C1a, a mechanism for gating regulation that may also apply to other Kv channels. PMID: 19690160
  49. Under suitable conditions, a docked state, mediated by trans-SNARE interactions, can be isolated representing an intermediate in the fusion pathway. PMID: 19843696

Show More

Hide All

Database Links
Protein Families
Synaptobrevin family
Subcellular Location
Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane; Single-pass type IV membrane protein. Cell membrane.
Tissue Specificity
Nervous system specific. A higher level expression is seen in the brain as compared to the spinal cord. Expressed in hippocampal neurons.

Q&A

What is the molecular structure of rat VAMP2 and how does it compare to other species?

Rat VAMP2 is a relatively small protein (approximately 116 amino acids) that transforms from a largely unstructured state to an ordered conformation upon interaction with other SNARE proteins. The protein consists of four distinct domains: a proline-rich N-terminal domain (residues 1-30), a SNARE motif/core domain (residues 31-85), a juxtamembrane domain (JMD, residues 86-95), and a transmembrane domain (TMD, residues 96-114) . This structural organization is highly conserved across mammalian species, with the SNARE motif showing particularly high sequence homology. Rat VAMP2 has several synonyms including RATVAMPB, RATVAMPIR, SYB, and Syb2, with a gene ID of 24803 and an ORF size of 351 bp . The transformation from disordered to ordered structure during SNARE complex formation releases free energy that helps drive membrane fusion, highlighting the functional significance of VAMP2's structural plasticity in cellular processes.

What are the primary cellular functions of VAMP2 in neurons and other cell types?

VAMP2 serves several critical functions across different cell types, with its most well-characterized role being in neuronal synaptic transmission. In neurons, VAMP2 is a key component in the SNARE complex that mediates synaptic vesicle fusion with the presynaptic membrane, enabling neurotransmitter release . Beyond neurons, VAMP2 plays important roles in multiple cellular processes: it serves as a resident protein of insulin-sensitive glucose transporter type 4 (GLUT4) compartments, facilitating GLUT4 vesicle incorporation into the cell surface in response to insulin ; it mediates cAMP-stimulated renin release in juxtaglomerular cells of the kidney ; and it contributes to CNS myelination by driving membrane expansion in oligodendrocytes . Additionally, studies in tetanus neurotoxin-treated hippocampal neurons have demonstrated that VAMP2 is the only known v-SNARE that can support dense-core vesicle (DCV) fusion . These diverse functions highlight VAMP2's central role in regulated exocytosis across multiple cell types and physiological contexts.

How is recombinant rat VAMP2 typically produced for research applications?

Recombinant rat VAMP2 for research applications is typically produced using bacterial, mammalian, or insect cell expression systems following molecular cloning of the rat VAMP2 gene (RefSeq# BC074003) . The production process generally involves several key steps: (1) PCR amplification of the rat VAMP2 coding sequence from appropriate source material; (2) Cloning into an expression vector with suitable promoters (commonly CMV for mammalian expression) ; (3) Transformation or transfection of host cells with the recombinant vector; (4) Expression induction and protein production; (5) Cell harvesting and protein extraction; and (6) Purification using affinity chromatography or other suitable methods. For viral expression systems, adenoviral vectors are commonly used, with human adenovirus Type5 (dE1/E3) serving as a typical backbone . The recombinant protein may include additional sequences such as affinity tags for purification or detection, and reporter genes (GFP, CFP, YFP, RFP, or mCherry) may be included to facilitate visualization . The final preparation is typically stored in a buffer containing DMEM, 2% BSA, and 2.5% glycerol to maintain stability .

What experimental approaches can distinguish between VAMP2 and VAMP3 functions in cells with overlapping expression?

Distinguishing between VAMP2 and VAMP3 functions in cells with overlapping expression requires targeted experimental strategies due to their functional redundancy. RNA interference techniques employing isoform-specific siRNAs or shRNAs represent a primary approach, as demonstrated in studies of renin release where VAMP2-specific knockdown impaired cAMP-stimulated secretion by ~67%, while VAMP3 knockdown had no effect on this process . Adenoviral delivery of isoform-specific shRNAs typically achieves 50-60% protein reduction, sufficient to reveal functional differences . CRISPR/Cas9 gene editing offers another approach, enabling complete knockout of specific isoforms. Rescue experiments using RNAi-resistant constructs can confirm specificity and rule out off-target effects. Pharmacological approaches utilizing toxins with differential sensitivity (tetanus neurotoxin cleaves VAMP2 but not all VAMPs) provide additional tools . Double knockdown/knockout experiments followed by selective re-expression of individual isoforms can reveal specific functions. In oligodendrocytes, where VAMP2 and VAMP3 are expressed at comparable levels, combined knockdown approaches have been necessary to overcome functional redundancy and reveal their roles in myelin sheath growth . Finally, super-resolution microscopy with isoform-specific antibodies can identify spatial segregation that may indicate functional specialization.

How does the transmembrane domain of VAMP2 contribute to fusion pore dynamics beyond membrane anchoring?

The transmembrane domain (TMD) of VAMP2 plays sophisticated roles in fusion pore dynamics that extend far beyond simple membrane anchoring. TMD mutations can significantly alter the maximum rise rate of miniature excitatory postsynaptic currents (mEPSCs), indicating direct involvement in regulating neurotransmitter flux through the fusion pore . Research has revealed that specific TMD residues interact with neurotransmitters (such as glutamate) as they pass through the fusion pore, effectively modulating the kinetics of synaptic release . The TMD influences fusion pore stability and expansion by mediating lipid mixing during membrane merger, with certain mutations selectively impairing this process without affecting protein interactions. Additionally, the α-helical structure of the TMD likely contributes to membrane curvature, creating local distortions that lower the energy barrier for fusion pore formation. The length and hydrophobicity of the TMD also affect its interaction with the lipid bilayer, influencing the initial size of fusion pores and thereby the rate of content release. These findings collectively demonstrate that the VAMP2 TMD actively participates in the mechanics of fusion, serving as both a structural scaffold and functional regulator of the fusion machinery.

What methodological approaches are most effective for visualizing VAMP2 trafficking in live cells?

Visualizing VAMP2 trafficking in live cells requires specialized techniques to overcome challenges related to the protein's small size, rapid dynamics, and dense localization patterns. Total Internal Reflection Fluorescence (TIRF) microscopy represents one of the most effective approaches, as it selectively illuminates molecules within 100-200 nm of the plasma membrane, providing excellent signal-to-noise ratio for visualizing VAMP2-containing vesicles near the membrane surface. Fusion of VAMP2 with pH-sensitive fluorescent proteins (pHluorins) enables specific detection of exocytosis events, as the fluorescence increases dramatically when vesicles fuse and the protein encounters the neutral extracellular environment. Spinning disk confocal microscopy offers a good balance between speed and resolution for tracking VAMP2-positive vesicles in three dimensions. For highest spatial resolution, lattice light-sheet microscopy can be employed, providing rapid 3D imaging with minimal phototoxicity for long-term tracking of VAMP2 vesicles. Fluorescence Recovery After Photobleaching (FRAP) and photoactivation techniques allow measurement of VAMP2 mobility and turnover rates. To minimize functional interference, careful tag placement is crucial—N-terminal tagging is generally preferred, as C-terminal modifications may disrupt transmembrane domain function. Finally, dual-color imaging with markers for specific compartments (synaptic vesicles, endosomes, etc.) provides context for understanding VAMP2 trafficking patterns in relation to cellular architecture.

How do post-translational modifications affect VAMP2 function in different cellular contexts?

Post-translational modifications (PTMs) of VAMP2 serve as critical regulatory mechanisms for fine-tuning its function across different cellular contexts. Phosphorylation represents one of the most significant VAMP2 modifications, with phosphorylation at Ser61 by casein kinase 2 promoting VAMP2's interaction with the adaptor protein Snapin, thereby enhancing exocytosis. Conversely, phosphorylation at Thr53 by protein kinase C has been shown to inhibit SNARE complex assembly, potentially serving as a negative regulatory mechanism. Ubiquitination of VAMP2 regulates its degradation and recycling, influencing protein half-life and availability for repeated fusion events. Palmitoylation, though less extensively studied for VAMP2 than other SNARE proteins, may affect its membrane microdomain localization. In neurons, these modifications collectively regulate synaptic vesicle mobilization, docking, and fusion probability, thereby fine-tuning neurotransmitter release kinetics. In endocrine cells, PTMs of VAMP2 affect hormone secretion patterns, as evidenced by studies showing phosphorylation-dependent regulation of insulin and renin release . In oligodendrocytes, where VAMP2 drives membrane expansion for myelination, PTMs likely modulate the balance between membrane addition and compaction during myelin sheath formation . The complex interplay of these modifications provides cells with multiple layers of control over VAMP2-mediated exocytosis, allowing context-specific regulation of membrane trafficking.

What are the critical factors for optimizing recombinant rat VAMP2 expression in different experimental systems?

Optimizing recombinant rat VAMP2 expression requires system-specific considerations across various experimental platforms. For adenoviral expression systems, several factors significantly influence outcomes: promoter selection (CMV promotes strong constitutive expression, while tissue-specific promoters enable targeted expression) ; vector capacity (human adenovirus Type5 with dE1/E3 deletions provides room for VAMP2 plus reporter genes) ; and purification methods (typically involving gradient centrifugation followed by titer determination). In mammalian cell transfection, key optimization factors include cell confluency (70% is optimal for many cell lines such as U-87 MG and Hep G2) ; transfection reagent selection based on cell type; and expression duration (24-72 hours depending on experimental needs). For bacterial expression systems producing purified protein, codon optimization for E. coli, inclusion of solubility tags, and controlled induction temperature (typically reduced to 16-18°C) prevent inclusion body formation. Expression vectors should be designed with consideration of fusion tags (His, GST, MBP) that facilitate purification without interfering with VAMP2 function, particularly avoiding modifications to the critical transmembrane domain. Finally, storage conditions significantly impact protein stability, with optimal preservation achieved in buffers containing DMEM, 2% BSA, and 2.5% glycerol . Validation of expressed protein should involve both functional assays and structural confirmation to ensure native-like behavior in the chosen experimental system.

How can researchers accurately quantify VAMP2-mediated vesicle fusion events in different cell types?

Accurate quantification of VAMP2-mediated vesicle fusion requires tailored approaches for different cell types and experimental questions. In neuronal systems, electrophysiological recordings represent the gold standard, measuring miniature excitatory postsynaptic currents (mEPSCs) with analysis of frequency, amplitude, and rise kinetics to detect changes in fusion pore dynamics . For more direct visualization, optical approaches using pH-sensitive fluorescent proteins (pHluorins) fused to VAMP2 allow real-time monitoring of fusion events, with automated analysis software quantifying event frequency, amplitude, and spatial distribution. In endocrine cells such as juxtaglomerular cells, quantification typically involves measuring hormone release (e.g., renin) using ELISA or radioimmunoassay methods, with results normalized to total cellular content to account for expression differences . A standardized approach involves establishing baseline release (typically 0.6-0.8% of total content), measuring stimulated release (e.g., 2.1% after cAMP stimulation), and comparing these values between control and experimental conditions . For high-resolution analysis, amperometry provides single-vesicle resolution in cells releasing oxidizable transmitters, while capacitance measurements detect membrane surface area changes during exocytosis. In cellular models of myelination, where VAMP2 mediates membrane expansion, quantitative imaging of membrane addition rates combined with electron microscopy of myelin ultrastructure provides functional assessment . Regardless of approach, inclusion of appropriate controls (scrambled shRNAs for knockdown studies, unstimulated baselines, and vector-only controls for overexpression) is essential for accurate interpretation of results.

What controls and validation steps are essential when using recombinant rat VAMP2 antibodies in immunofluorescence and Western blot applications?

Rigorous validation of recombinant rat VAMP2 antibodies requires multiple controls and quality checks across applications. For immunofluorescence, cellular validation is paramount—antibodies should be tested in multiple cell types (such as U-87 MG and Hep G2) to verify consistent staining patterns . Antibody performance must be validated across different fixation methods (paraformaldehyde, methanol, etc.) as each may affect epitope accessibility. Knockdown controls using VAMP2-specific shRNA (achieving >50% protein reduction) help confirm staining specificity . For Western blotting, molecular weight verification is critical—rat VAMP2 should appear at approximately 13 kDa, with additional bands potentially indicating degradation or cross-reactivity with other VAMP isoforms. Cross-species reactivity should be established if working with multiple model organisms. Recombinant monoclonal antibodies offer advantages over polyclonal alternatives, including better specificity, lot-to-lot consistency, and broader epitope recognition . Concentration optimization through titration experiments determines the minimum antibody concentration yielding maximum specific signal with minimal background. Competition assays with purified recombinant VAMP2 protein can further confirm specificity. When quantifying Western blot results, normalization to appropriate loading controls and use of standard curves with purified protein enables accurate quantification. Finally, comparisons between multiple antibodies targeting different VAMP2 epitopes can provide additional confidence in specificity, especially when distinguishing between highly homologous VAMP isoforms.

Antibody Validation ParameterWestern BlotImmunofluorescence
Molecular weight verification13 kDa bandN/A
Knockdown controls>50% reduction in band intensityReduced signal intensity
Cross-reactivity assessmentTest against VAMP1/3Co-staining with VAMP isoform antibodies
Fixation compatibilityN/ATest PFA, methanol, acetone
Cell type validationConsistent across tissuesTest in U-87 MG and Hep G2
Blocking optimization5% BSA or milk10% serum from secondary host

What are the most effective strategies for investigating VAMP2-mediated fusion in oligodendrocytes during myelination?

Investigating VAMP2-mediated fusion in oligodendrocytes during myelination requires specialized approaches that address both the unique cellular architecture and potential functional redundancy with other VAMP isoforms. RNA in situ hybridization techniques (RNAscope) represent an essential first step, enabling precise quantification of VAMP2 expression across different stages of oligodendrocyte differentiation and myelination . Since VAMP2 and VAMP3 are expressed at comparable levels in oligodendrocytes with potential functional redundancy, simultaneous knockdown of both isoforms is typically necessary to reveal their roles in membrane expansion . For in vitro studies, purified oligodendrocyte precursor cells co-cultured with neurons provide a controlled system to study myelination, with time-lapse imaging enabling visualization of membrane expansion dynamics. Viral vector-mediated expression of fluorescently-tagged VAMP2 in oligodendrocytes allows tracking of vesicle trafficking and fusion within developing myelin sheaths. Super-resolution microscopy techniques can resolve the nanoscale organization of VAMP2 within the confined spaces of myelin membranes. For in vivo approaches, conditional knockout strategies targeting both VAMP2 and VAMP3 in oligodendrocyte lineage cells circumvent the embryonic lethality of global VAMP2 knockout. Electron microscopy remains the gold standard for assessing ultrastructural changes in myelin following VAMP manipulation . Finally, functional studies examining node of Ranvier formation through immunostaining for paranodal proteins provide critical insights into how VAMP2/3-mediated vesicle fusion contributes to axon-myelin adhesion and domain organization during development .

How can recombinant rat VAMP2 be applied in neurodegenerative disease research models?

Recombinant rat VAMP2 offers valuable applications in neurodegenerative disease research models, particularly given that VAMP2 levels of all isoforms appear significantly lowered in Alzheimer's disease . For studying synaptopathies, recombinant VAMP2 can be employed in rescue experiments to determine whether restoring VAMP2 function ameliorates synaptic deficits. In cellular models of neurodegeneration, adenoviral vectors expressing rat VAMP2 (Ad-r-VAMP2) enable controlled restoration of protein levels in neurons with compromised vesicle release machinery . For Alzheimer's disease research specifically, recombinant VAMP2 can be used to investigate interactions with pathological proteins such as amyloid-β and tau, which may disrupt SNARE complex formation. Additionally, recombinant VAMP2 serves as a tool for developing high-throughput screening platforms to identify compounds that protect SNARE proteins from pathological modifications or degradation. In Parkinson's disease models, research indicates that α-synuclein may cross-bridge VAMP2 and acidic phospholipids to facilitate SNARE-dependent vesicle docking , making recombinant VAMP2 valuable for studying these interactions. For therapeutic development, VAMP2-targeting interventions require precise spatiotemporal control, achievable through optogenetic or chemogenetic modifications of recombinant constructs. Finally, recombinant VAMP2 protein serves as a standard in quantitative assays measuring VAMP2 levels in patient-derived samples, potentially contributing to biomarker development for synaptopathies associated with various neurodegenerative conditions.

What research applications exist for investigating VAMP2 in metabolic disorders involving insulin secretion?

VAMP2 plays a critical role in metabolic regulation, particularly in insulin secretion and glucose homeostasis, making it an important target for metabolic disorder research. VAMP2 functions as a resident protein of the insulin-sensitive glucose transporter type 4 (GLUT4) compartment and is required for GLUT4 vesicle incorporation into the cell surface in response to insulin . In pancreatic β-cells, VAMP2 mediates insulin granule fusion with the plasma membrane during glucose-stimulated insulin secretion. Research applications utilizing recombinant rat VAMP2 in this field include: developing models to investigate the molecular mechanisms of insulin resistance by studying VAMP2-mediated GLUT4 translocation; examining how lipotoxicity and glucotoxicity affect VAMP2 function in pancreatic β-cells using adenoviral delivery of wild-type or mutant VAMP2 ; investigating potential therapeutic targets by screening compounds that enhance VAMP2-mediated GLUT4 translocation or insulin granule fusion; and studying the effects of diabetes-associated mutations on VAMP2 trafficking and function. For in vivo applications, conditional VAMP2 knockout models in specific tissues (pancreas, skeletal muscle, adipose tissue) help delineate tissue-specific roles in glucose homeostasis. High-resolution imaging of fluorescently-tagged recombinant VAMP2 enables visualization of defects in GLUT4 or insulin granule dynamics in diabetic models. Finally, proteomic approaches using recombinant VAMP2 as bait can identify novel interaction partners that might be dysregulated in metabolic disorders, potentially revealing new therapeutic targets for diabetes and related conditions.

How should researchers design experiments to investigate VAMP2-dependent renin release in hypertension models?

Designing experiments to investigate VAMP2-dependent renin release in hypertension models requires careful consideration of both in vitro and in vivo approaches. In vitro experiments should begin with isolated juxtaglomerular (JG) cells, the primary site of renin synthesis and release, with VAMP2 manipulation achieved through adenoviral vectors encoding either VAMP2 for overexpression or VAMP2 shRNA for knockdown (achieving approximately 54% reduction in protein levels) . Experimental designs should include both baseline and cAMP-stimulated conditions, as VAMP2 is specifically implicated in regulated rather than constitutive renin release . Results should be quantified as percentage of total renin content to normalize for cell number variations, with typical values ranging from 0.6-0.8% release at baseline to 2.1-2.3% after cAMP stimulation in control cells . For in vivo studies, kidney-specific VAMP2 manipulation using targeted viral delivery or conditional knockout models circumvents the embryonic lethality of global VAMP2 deletion. Blood pressure monitoring through telemetry provides continuous assessment of hypertension development, while plasma renin activity measurements evaluate systemic consequences of altered VAMP2 function. Importantly, experiments should distinguish between VAMP2 and VAMP3 functions, as VAMP3 knockdown does not affect cAMP-stimulated renin release despite similar expression patterns . Researchers should also consider potential compensation by other VAMP isoforms that are not cleaved by tetanus toxin (VAMP7 or VAMP8) . Finally, therapeutic implications can be explored by testing whether enhancing VAMP2 function through genetic overexpression or pharmacological means affects renin release and blood pressure regulation in established hypertension models.

What advanced techniques can be used to study the interaction between VAMP2 and other SNARE proteins during membrane fusion?

Advanced techniques for studying VAMP2 interactions with other SNARE proteins during membrane fusion span structural, biophysical, and high-resolution imaging approaches. Cryo-electron microscopy provides near-atomic resolution of VAMP2 within the SNARE complex, revealing how different domains contribute to complex assembly. Single-molecule FRET (smFRET) measures distances between specific residues in VAMP2 and other SNARE proteins during complex formation and membrane fusion, tracking conformational changes with nanometer precision and millisecond time resolution. In vitro reconstitution systems using purified VAMP2 and partner proteins in artificial liposomes enable controlled study of fusion processes without cellular complexity. For cellular studies, proximity ligation assay (PLA) detects VAMP2 interactions with syntaxin-1A and SNAP-25 with high sensitivity, generating fluorescent signals only when proteins are within 40 nm of each other. Optogenetic approaches using light-sensitive domains fused to VAMP2 allow precise temporal control of SNARE interactions. Biochemical approaches include chemical cross-linking mass spectrometry (CXMS), which identifies contact points between VAMP2 and other proteins in native complexes. Live-cell super-resolution microscopy techniques such as STORM or PALM visualize SNARE protein distributions at nanoscale resolution. Combinations of these techniques are particularly powerful, such as correlative light and electron microscopy (CLEM) to link functional observations with ultrastructural details of fusion sites where VAMP2 localizes. These advanced approaches collectively provide unprecedented insights into how VAMP2 participates in the dynamic process of SNARE-mediated membrane fusion across different biological contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.