Recombinant Rat Vesicle-associated membrane protein 3 (Vamp3)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Rat VAMP3

Vesicle-associated membrane protein 3 (VAMP3), also known as cellubrevin, is a rodent homolog of human VAMP3, a member of the SNARE protein family critical for membrane fusion processes. Recombinant Rat VAMP3 is a bioengineered version of this protein, often expressed in yeast or E. coli, with modifications like His-tag purification for experimental use. Its applications span studies on exocytosis, inflammation, and electrolyte transport, leveraging its conserved structural and functional properties across species .

Functional Roles in Cellular Processes

Recombinant Rat VAMP3 has been instrumental in elucidating its role in:

Platelet Secretion

VAMP3 mediates granule exocytosis in platelets, interacting with syntaxin 4 and SNAP-23. Recombinant VAMP3 inhibits:

Granule TypeInhibition by rVAMP3Method
α-granules100% (P-selectin release)Flow cytometry
Dense granules~80% (serotonin release)Radiometric assays

Renal NaCl Reabsorption

In thick ascending limb (TAL) cells, VAMP3 facilitates constitutive NKCC2 (Na-K-Cl cotransporter 2) trafficking to the apical membrane. Key findings:

ParameterWild-TypeVAMP3 KO MiceSource
Surface NKCC2100%54%
Total NKCC2 Expression100%34%
Urine OsmolalityNormalDiluted

Macrophage Cytokine Secretion

VAMP3 regulates TNF-α and IL-6 release in myeloid cells. Myeloid-specific Vamp3 deletion reduces:

CytokineWT MacrophagesVAMP3ΔmyelSource
TNF-α100%50–70%
IL-6100%50–70%

PI4K2A-Dependent Trafficking

VAMP3 sorting to recycling endosomes and the plasma membrane requires PI4K2A and PtdIns4P production:

ConditionVAMP3 LocalizationImpact
PI4K2A KnockdownAccumulation in late endosomesReduced surface VAMP3 (~40%)
Sac1 RecruitmentLoss of PtdIns4P on endosomesDelayed trafficking to Golgi

SNARE Complex Formation

VAMP3 forms ternary complexes with syntaxin 4 and SNAP-23, enabling vesicle fusion. Dominant-negative VAMP3 mutants (e.g., TeNT-resistant variants) disrupt this process .

Research Applications and Experimental Tools

Recombinant Rat VAMP3 is used in:

  • Surface Biotinylation: Detecting apical membrane localization in TAL cells .

  • Live-Cell Imaging: Tracking VAMP3-GFP fusion with target membranes .

  • FRAP Assays: Measuring retrograde trafficking rates in COS-7 cells .

Therapeutic and Physiological Implications

Disease/ProcessVAMP3 RolePotential Target
HypertensionRegulates NKCC2-mediated NaCl reabsorptionInhibiting VAMP3 to reduce Na+ load
Inflammatory PainFacilitates cytokine secretion in macrophagesVAMP3 inhibitors for pain relief
ThrombosisMediates platelet granule secretionBlocking VAMP3 to limit platelet activation

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us and we will prioritize developing it accordingly.
Synonyms
Vamp3; Syb3; Vesicle-associated membrane protein 3; VAMP-3; Cellubrevin; CEB; Synaptobrevin-3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-103
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Vamp3
Target Protein Sequence
MSTGVPSGSSAATGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCKMWAIGISVLVIIVIIIIVWCVS
Uniprot No.

Target Background

Function
SNARE involved in vesicular transport from the late endosomes to the trans-Golgi network.
Gene References Into Functions
  1. VAMP3 mRNA is increased during nerve regeneration of the facial motor nucleus after axotomy. PMID: 12191731
Database Links
Protein Families
Synaptobrevin family
Subcellular Location
Membrane; Single-pass type IV membrane protein. Cell junction, synapse, synaptosome.
Tissue Specificity
Ubiquitous.

Q&A

What is the basic structure and function of rat VAMP3?

VAMP3 (also known as cellubrevin) is a vesicle-associated membrane protein belonging to the SNARE (Soluble N-ethylmaleimide-sensitive factor Attachment protein REceptor) family. It contains an N-terminal cytoplasmic domain, a SNARE motif, and a C-terminal transmembrane domain (TMD). VAMP3 functions as a v-SNARE that mediates vesicle fusion with target membranes, particularly in endosomal recycling pathways .

The protein primarily localizes to early/recycling endosomes and plays crucial roles in protein trafficking between the endocytic recycling compartment (ERC), Golgi, and plasma membrane. VAMP3 preferentially segregates into tubular membranes where it facilitates fusion with the ERC and Golgi, distinguishing it from other R-SNAREs like VAMP7 that regulate fusion with late endosomes .

How does VAMP3 differ from other VAMP isoforms?

VAMP3 differs from other VAMP family members in several key aspects:

  • Expression levels: In 3T3-L1 adipocytes, VAMP3 is highly expressed at approximately 1.5 × 10^6 copies/cell, compared to VAMP2 (8.6 × 10^5 copies/cell), VAMP4 (4.8 × 10^5 copies/cell), and the much lower expressed VAMP5 and VAMP7 (<1 × 10^5 copies/cell) .

  • Localization pattern: Unlike VAMP2 which is predominantly found in synaptic vesicles, VAMP3 primarily localizes to endosomes and recycling compartments .

  • Functional redundancy: While VAMP3 knockout mice display normal constitutive, insulin- and exercise-regulated GLUT4 trafficking, suggesting functional redundancy with other VAMPs in glucose homeostasis , it plays unique roles in other systems such as kidney ion transport .

  • Transmembrane domain effects: Research using chimeric proteins has shown that swapping the TMD of VAMP2 with that of other VAMPs (including VAMP1 and VAMP8) affects fusion pore dynamics, suggesting functional specialization in the membrane-embedded regions .

What expression systems are most effective for producing recombinant rat VAMP3?

For producing recombinant rat VAMP3, several expression systems have been successfully utilized in research settings:

  • Bacterial expression (E. coli): Commonly used for producing the cytoplasmic domain of VAMP3, which is sufficient for many protein-protein interaction studies. This system allows for high yield but may lack post-translational modifications.

  • Mammalian expression systems: For studies requiring proper post-translational modifications and trafficking, researchers commonly use:

    • HEK293 cells for transient expression

    • COS-7 cells for imaging studies of protein localization

    • RBL-2H3 cells for studying VAMP3 function in mast cell degranulation

  • Lentiviral expression systems: For stable knockdown or expression studies, lentiviral systems have been effectively used, as demonstrated in studies with RBL-2H3 cells where shRNA TRCN0000110516 was used to knockdown VAMP3 expression .

When selecting an expression system, consider the downstream applications and whether post-translational modifications are critical for your research questions.

What are the key considerations when designing constructs for recombinant rat VAMP3 expression?

When designing constructs for recombinant rat VAMP3 expression, consider the following methodological aspects:

  • Tagging strategy: Common tags include:

    • HA tags for immunoprecipitation studies

    • GFP/RFP for live-cell imaging and trafficking studies

    • His-tags for purification of bacterial expressed proteins

  • Domain considerations:

    • For protein interaction studies, the cytoplasmic domain alone may be sufficient

    • For trafficking or membrane insertion studies, include the transmembrane domain

    • Consider the orientation of tags to avoid interfering with SNARE complex formation

  • Cloning approach: For fluorescent protein fusions, electroporation has been successfully used with vectors like pTagGFP2-N and pTagRFP-C .

  • Expression control: Use appropriate promoters (e.g., GFAP promoter for astrocyte-specific expression or CAG for ubiquitous expression, as demonstrated in in utero electroporation studies) .

How can researchers effectively measure VAMP3 trafficking dynamics in live cells?

Several methodological approaches have been validated for studying VAMP3 trafficking dynamics:

  • Fluorescence Recovery After Photobleaching (FRAP):

    • Photobleach GFP-VAMP3 at targeted subcellular regions (e.g., perinuclear recycling endosome and Golgi)

    • Measure the rate of fluorescence recovery to quantify VAMP3 trafficking kinetics

    • This approach has been used to show PI4K2A knockdown substantially reduces the rate of VAMP3 FRAP at perinuclear membranes

  • Live-cell confocal microscopy:

    • Co-express GFP-VAMP3 with markers for different compartments (e.g., LAMP-1-mRFP for lysosomes)

    • Quantify colocalization using Pearson's correlation coefficient

    • Track individual vesicles to analyze movement patterns and fusion events

  • Single-vesicle resolution imaging:

    • Use total internal reflection fluorescence (TIRF) microscopy to visualize fusion events at the plasma membrane

    • This approach has been used to study the role of proteins like RPH3A in regulating VAMP3-mediated exocytosis

When analyzing VAMP3 trafficking dynamics, it's important to use appropriate controls, such as comparing wild-type and mutant VAMP3 variants or using pharmacological inhibitors of specific trafficking pathways.

What approaches are most effective for studying VAMP3 protein-protein interactions?

To study VAMP3 protein-protein interactions, several complementary approaches have proven effective:

  • Co-immunoprecipitation (Co-IP):

    • Express HA-tagged versions of potential interacting partners with GFP-tagged VAMP3

    • Immunoprecipitate VAMP3 and analyze co-precipitated proteins by western blotting

    • This approach revealed that VAMP3 interacts with PI4K2A independent of PI4K2A's catalytic activity

  • Pull-down assays using recombinant proteins:

    • Express GST-tagged VAMP3 or sections of VAMP3 in bacteria

    • Use the purified protein for pull-down assays with lysates from cells expressing potential binding partners

    • Analyze bound proteins by western blotting or mass spectrometry

  • Yeast two-hybrid screening:

    • Use the cytoplasmic domain of VAMP3 as bait to identify novel interaction partners

    • Validate hits using other methods like Co-IP or pull-down assays

  • Proximity labeling approaches:

    • Fuse VAMP3 to BioID or APEX2 to identify proteins in close proximity in living cells

    • This approach can identify both direct and indirect interactors in the native cellular context

When reporting interaction data, it's important to verify specificity by using appropriate controls, such as testing interaction with mutated versions of VAMP3 or other VAMP isoforms.

How can researchers effectively design VAMP3 knockdown or knockout experiments?

For studying VAMP3 function through loss-of-function approaches, several validated strategies exist:

When performing knockdown/knockout experiments, it's crucial to:

  • Validate the specificity of your approach by checking for compensatory changes in other VAMP isoforms

  • Include appropriate rescue experiments to confirm phenotype specificity

  • Consider the possibility of functional redundancy, as seen in some VAMP3 knockout studies

What are the key considerations when interpreting contradictory data in VAMP3 research?

When facing contradictory results in VAMP3 research, consider these methodological approaches:

  • Triangulation approach:

    • Use multiple methods to validate findings (e.g., combining imaging, biochemical, and functional assays)

    • Be aware that triangulation aims for convergent findings but may not be appropriate for complex phenomena

  • Complementarity approach:

    • Recognize that different methods may reveal different aspects of VAMP3 function

    • When findings appear contradictory, consider if they represent different facets rather than true contradictions

  • Multi-dimensional explanations:

    • Acknowledge that VAMP3 functions in complex multi-dimensional cellular processes

    • Contradictory findings may reflect this complexity rather than experimental error

Specific considerations for VAMP3 research:

  • Temporal dynamics: VAMP3 functions may differ at different time points. For example, in mast cell degranulation, VAMP3 knockdown cells show reduced β-hexosaminidase release early (30 min) but not later (180 min) after stimulation .

  • Cell-type specificity: VAMP3 may have different roles in different cell types. While it's dispensable for insulin-stimulated glucose transport in adipocytes , it's essential for NKCC2 trafficking in kidney cells .

  • Compensatory mechanisms: When interpreting knockout phenotypes, consider potential compensation by other VAMP isoforms, which may mask phenotypes in long-term but not acute loss-of-function studies.

How can recombinant VAMP3 be used to study vesicular trafficking in immune cells?

Recombinant VAMP3 has been instrumental in studying immune cell trafficking through several methodological approaches:

  • Mast cell degranulation studies:

    • VAMP3 knockdown in RBL-2H3 cells (a model for mast cell IgE-mediated responses) revealed:

      • Reduced β-hexosaminidase release in early (30 min) but not late (180 min) phases after antigen stimulation

      • Altered granule-to-granule fusion during exocytosis

      • Enhanced FcεRI phosphorylation despite reduced surface expression

  • Quantitative analysis of granule size:

    • Express GFP-tagged CD63 (granule marker) with/without RFP-VAMP3 in mast cells

    • Measure granule size distribution after antigen stimulation

    • Results showed VAMP3-positive compartments significantly increase in size 30 minutes after antigen stimulation, suggesting VAMP3 mediates granule-to-granule fusion

Table: VAMP3 granule size changes during mast cell activation

Time after Ag stimulationAverage VAMP3+ granule size (relative units)Significance
Unstimulated1.0 (baseline)-
30 minutes1.5-2.0p<0.001
180 minutes0.9-1.1 (returns to baseline)NS

These findings suggest VAMP3 plays a time-dependent role in immune cell secretory pathways, with particular importance in early phase granule fusion events.

What is known about VAMP3's role in polarized trafficking in epithelial cells?

Research on VAMP3's role in polarized trafficking in epithelial cells has revealed several important methodological approaches and findings:

  • Surface biotinylation assays:

    • Used to quantify steady-state surface expression of transporters like NKCC2

    • In VAMP3 knockout mice, steady-state surface NKCC2 expression was decreased by 46% compared to wild-type mice

    • The surface to intracellular NKCC2 ratio was reduced by 20% (from 0.050 to 0.040) in VAMP3 knockout mice

  • Thick ascending limb (TAL) cell studies:

    • VAMP3 silencing via adenovirus-delivered shRNA reduced VAMP3 expression by ~70% in rat TALs

    • This approach revealed VAMP3 mediates constitutive steady-state surface expression of NKCC2

  • Stimulation response analysis:

    • While VAMP2 mediates cAMP-stimulated NKCC2 trafficking, VAMP3 is specifically involved in constitutive trafficking

    • This functional specialization demonstrates how different VAMP isoforms contribute to distinct aspects of polarized protein delivery

When studying VAMP3 in epithelial trafficking, it's important to:

  • Distinguish between constitutive and stimulated trafficking pathways

  • Verify the specificity of effects by measuring multiple membrane proteins

  • Include appropriate controls to confirm intracellular proteins aren't inadvertently labeled in surface biotinylation assays (e.g., GAPDH should only be detected in intracellular fractions)

What are common technical challenges when working with recombinant VAMP3 and how can they be addressed?

Researchers face several technical challenges when working with recombinant VAMP3:

  • Protein solubility and purification:

    • Challenge: The hydrophobic transmembrane domain can cause aggregation

    • Solution: Express only the cytoplasmic domain for interaction studies, or use detergents like CHAPS or octylglucoside for full-length protein purification

  • Antibody specificity:

    • Challenge: Cross-reactivity with other VAMP isoforms

    • Solution: Use validated antibodies like those from Cell Signaling Technology (#13640) that specifically recognize VAMP3 without cross-reacting with VAMP1 or VAMP2

    • Validate antibody specificity in your experimental system using positive controls (recombinant VAMP3) and negative controls (VAMP3 knockout samples)

  • Functional redundancy:

    • Challenge: Knockdown/knockout may not show phenotypes due to compensation

    • Solution: Use acute depletion methods or combine with inhibition of potential compensatory VAMPs

    • Consider using dominant-negative approaches that may overcome compensation

  • Tracking specific pools of VAMP3:

    • Challenge: Distinguishing newly synthesized vs. recycling VAMP3

    • Solution: Use approaches like RUSH (Retention Using Selective Hooks) or fluorescence-based pulse-chase methods

How can researchers quantitatively assess VAMP3 localization and trafficking in experimental systems?

Several quantitative approaches have been validated for assessing VAMP3 localization and trafficking:

  • Colocalization analysis:

    • Measure Pearson's correlation coefficient between VAMP3 and compartment markers

    • In studies of tumor protein D52, VAMP3 showed high colocalization (72.5% ± 6.5%) compared to other markers

  • Intensity measurement of subcellular localization:

    • Measure raw intensity density (RawIntDen) of VAMP3 at specific subcellular locations

    • Normalize to area to account for heterogeneity in compartment sizes

    • Further normalize to gain settings when comparing across multiple images

  • Fluorescence recovery after photobleaching (FRAP):

    • Quantify recovery rate after photobleaching VAMP3 in specific compartments

    • Studies showed PI4K2A knockdown substantially reduced FRAP rate at perinuclear membranes

    • Control experiments with PIK93 (inhibitor of PI4KB) showed no effect, confirming specificity of PI4K2A effect

  • Surface biotinylation:

    • Quantify VAMP3-dependent trafficking of cargo proteins to the cell surface

    • Calculate surface/total ratio to normalize for expression level differences

    • Include controls to verify specificity (e.g., GAPDH should not be biotinylated)

Table: Relative colocalization of D52 with vesicular markers including VAMP3

Marker% Colocalization with D52 wild-type
AP356.9 ± 13.2
Dextran36.0 ± 3.5
Rab27A61.7 ± 10.5
VAMP772.5 ± 6.5
LAMP139.7 ± 3.6

Source: Data from reference , representing means ± SE quantified from multiple (n ≥ 10) reconstructed z-series images obtained from 3 separate tissue preparations.

What emerging techniques might advance our understanding of VAMP3 function?

Several cutting-edge methodologies show promise for advancing VAMP3 research:

  • Super-resolution microscopy:

    • Techniques like STED, PALM, and STORM can resolve VAMP3 distribution at nanoscale resolution

    • This allows visualization of VAMP3 clustering and organization within subdomains of endosomes

  • Optogenetic approaches:

    • Light-controllable versions of VAMP3 would allow temporal control over SNARE complex formation

    • This could help distinguish between trafficking steps that occur in rapid succession

  • Advanced proteomics:

    • Proximity-dependent labeling approaches (BioID, APEX) fused to VAMP3 can identify the VAMP3 interactome in different cellular compartments

    • Quantitative phosphoproteomics can reveal how phosphorylation regulates VAMP3 function and interactions

  • Cryo-electron microscopy:

    • Structural studies of VAMP3 within SNARE complexes at high resolution

    • This could reveal subtle differences between VAMP3 and other v-SNAREs that explain functional specificity

  • Single-molecule tracking:

    • Following individual VAMP3 molecules in living cells

    • This could reveal heterogeneity in VAMP3 behavior and identify distinct subpopulations

What are the major unresolved questions in VAMP3 research?

Despite significant advances, several key questions remain unresolved in VAMP3 research:

  • Isoform specificity mechanisms:

    • How do cells ensure VAMP3 is incorporated into specific vesicle populations?

    • What factors determine which v-SNARE is used for particular trafficking pathways?

  • Regulatory mechanisms:

    • How is VAMP3 function regulated by post-translational modifications?

    • What signaling pathways control VAMP3 availability and activity?

  • Disease relevance:

    • What is the contribution of VAMP3 dysfunction to human diseases?

    • Could VAMP3-targeted approaches have therapeutic potential?

  • Complex redundancy:

    • How do cells compensate for VAMP3 loss in knockout models?

    • What determines whether redundancy mechanisms are activated?

  • Membrane domain interactions:

    • How does the transmembrane domain of VAMP3 contribute to its functional specificity?

    • What role do membrane lipids play in regulating VAMP3-mediated fusion?

These questions represent promising areas for future investigation using the advanced methodologies described above, potentially yielding new insights into the fundamental mechanisms of membrane trafficking and fusion.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.