Recombinant Rat Vesicle-trafficking protein SEC22a (Sec22a)

Shipped with Ice Packs
In Stock

Description

Functional Insights

Key Roles in Vesicle Trafficking:

  • Mediates ER-to-Golgi transport through interactions with COPII coat proteins

  • Participates in SNARE complex assembly via SNAP receptor activity

  • Distinct localization compared to rbet1: SEC22a resides on ER membranes, while rbet1 localizes to Golgi compartments

Pathway Involvement:

PathwayAssociated Proteins
COPII Vesicle TransportSEC16B, BET1, TRAPPC6B, YKT6
ER-to-Golgi Anterograde TransportTFG, USO1, TRAPPC10, LMAN2L
Asparagine N-linked GlycosylationDDOST, MPDU1, TMED10

Research Applications

Experimental Uses:

  • Vesicle Reconstitution Assays: Used to study COPII coat recruitment dynamics

  • Chemical Interaction Studies: Responsive to epigenetic modifiers (e.g., valproic acid decreases methylation)

  • Trafficking Mutant Analysis: CRISPR KO models reveal impaired proTGFα sorting

Chemical Modulation Data:

CompoundEffect on SEC22aSource
Valproic AcidAlters mRNA splicing & expression RGD:621659
CisplatinUpregulates mRNA levels RGD:621659
Brefeldin ADisrupts Golgi-localized partners PubMed:8621431

Interaction Network

Direct Binding Partners:

  • Syntaxin 17 (ER-Golgi SNARE complex)

  • DTX2 (E3 ubiquitin ligase)

  • STX4 (plasma membrane SNARE)

Regulatory Dynamics:

  • Requires Sec24 isoforms A/B for COPII vesicle recruitment

  • Brefeldin A treatment redistributes associated proteins to ER-intermediate compartments

Technical Considerations

Expression Optimization:

  • HEK293 systems yield properly folded membrane proteins with post-translational modifications

  • Cell-free systems suitable for isotopic labeling in structural studies

Common Challenges:

  • Aggregation in E. coli due to transmembrane domain hydrophobicity

  • Tag interference reported in SNARE complex assembly assays

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. Please specify your desired tag type for preferential development.
Synonyms
Sec22a; Sec22l2; Vesicle-trafficking protein SEC22a; SEC22 vesicle-trafficking protein homolog A; SEC22 vesicle-trafficking protein-like 2; rSec22a
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-307
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Sec22a
Target Protein Sequence
MSMILSASVVRVRDGLPLSASTDCEQSAGVQECRKYFKMLSRKLAQFPDRCTLKTGRHNI NFISSLGVSYMMLCTENYPNVLAFSFLDELQKEFITTYNMMKTNTAVRPYCFIEFDNFIQ RTKQRYNNPRSLSTKINLSDMQMEIKLRPPYQIPMCELGSANGVTSAFSVDCKGAGKISS AHQRLEPATLSGIVAFILSLLCGALNLIRGFHAIESLLQSDGEDFSYMIAFFLGTAACLY QCYLLVYYTSWRNVKSFLTFGLICLCNMYLYELRNLWQLFFHVTVGAFVTLQIWLRQAQG KAPDHDV
Uniprot No.

Target Background

Function
Involved in vesicle transport between the endoplasmic reticulum (ER) and the Golgi apparatus.
Database Links
Protein Families
Synaptobrevin family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the fundamental function of SEC22a in cellular trafficking?

SEC22a functions as a vesicle-SNARE (v-SNARE) protein primarily enriched on the endoplasmic reticulum (ER) membrane. It mediates membrane fusion between vesicles derived from the ER and their target membranes in the Golgi apparatus. SEC22a accomplishes this by forming SNARE complexes with target membrane-localized t-SNAREs, such as Syntaxin 5 (Syx5). These complexes form helix bundles that drive the membrane fusion process essential for protein transport along the secretory pathway . The interaction between SEC22a and Syx5 has been experimentally confirmed through immunoprecipitation assays in cultured S2 cells, demonstrating that SEC22a indeed forms complexes with Syx5 to facilitate membrane trafficking . This molecular mechanism is conserved across species from yeast to mammals, underscoring the evolutionary importance of SEC22a in cellular function.

How does SEC22a differ structurally and functionally from other SEC22 family members?

SEC22a belongs to the SEC22 family of proteins that includes SEC22B and SEC22C in mammals. All SEC22 proteins contain a SNARE motif and a transmembrane domain, but they exhibit differences in their N-terminal regions and subcellular distributions. While SEC22a and SEC22B both participate in ER-to-Golgi trafficking, they may have distinct regulatory mechanisms and interaction partners .

Research methodologies to determine structural differences include:

  • Sequence alignment analysis to identify conserved and variable domains

  • Protein crystallography to resolve three-dimensional structures

  • Domain swapping experiments to determine functional significance of specific regions

  • Co-immunoprecipitation assays to identify unique binding partners

Functional differences can be investigated through knockout/knockdown studies, which have revealed that SEC22 proteins may have partially redundant functions. For instance, in yeast, the functions of Sec22p partially overlap with those of another gene, ykt6 . This redundancy may explain why SEC22B knockdown in mammalian cells does not cause autophagy defects, despite the role of Sec22p in autophagosome biogenesis in yeast .

What expression systems are most effective for producing recombinant Rat SEC22a?

For recombinant Rat SEC22a production, several expression systems have proven effective, each with specific advantages for different research applications:

Expression SystemAdvantagesLimitationsTypical YieldBest For
E. coliRapid growth, high yield, cost-effectiveLacks post-translational modifications, potential inclusion body formation10-50 mg/LStructural studies, antibody production
Insect cellsEukaryotic processing, proper foldingLonger production time, more expensive than bacterial systems5-20 mg/LFunctional assays, interaction studies
Mammalian cellsNative-like modifications, authentic foldingLowest yield, highest cost1-5 mg/LIn vivo functional studies
Lentiviral systemsAllows stable integration and expressionComplex workflow, biosafety considerationsVariableCellular studies requiring stable expression

Lentiviral activation particles have been developed specifically for SEC22a expression, such as the SEC22A Lentiviral Activation Particles system, which utilizes a synergistic activation mediator (SAM) transcription activation system to maximize the activation of endogenous gene expression . This approach is particularly valuable for studying SEC22a function in its native cellular context while achieving controlled upregulation.

The optimal purification strategy involves immobilized metal affinity chromatography (IMAC) using an N-terminal His-tag, followed by size exclusion chromatography to ensure high purity. For membrane-associated regions of SEC22a, detergent screening is essential to maintain protein stability and functionality.

How do SEC22a homodimers contribute to SNARE complex assembly and membrane fusion?

Recent research has revealed that SEC22a can form homodimers, which appear to be dynamic intermediates necessary for efficient intracellular transport. These homodimers have been detected through cysteine cross-linking approaches when cysteine residues were positioned in either the SNARE motif or the C-terminus of the transmembrane domain .

The functional significance of SEC22a homodimers lies in their potential role in promoting the assembly of higher-order SNARE complexes that catalyze membrane fusion. Experimental evidence indicates that the transmembrane domain of SEC22 is required for both efficient homodimer formation and membrane fusion, suggesting a mechanistic link between these processes .

Researchers investigating SEC22a homodimers should consider:

  • Position-specific effects: Cysteine scanning experiments have shown that the ability to form homodimers varies depending on the position of cysteine residues, indicating structural constraints on dimer formation.

  • Trans- vs. cis-arrangements: When specific SEC22 cysteine derivatives are present on both donor COPII vesicles and acceptor Golgi membranes, disulfide cross-links provide clear readouts on trans- and cis-SNARE arrangements during fusion events .

  • Dynamic nature: Evidence suggests these homodimers are not static structures but rather dynamic intermediates that facilitate the assembly of fusogenic SNARE complexes.

A proposed model for SEC22a homodimer function suggests that initial homodimer formation may serve to concentrate SEC22a at fusion sites, followed by dissociation and reassembly into heteromeric SNARE complexes with partners like Syntaxin 5 to drive membrane fusion.

What experimental approaches can resolve contradictory data regarding SEC22a's role in autophagy?

To resolve these contradictions, researchers should consider:

  • Compensatory mechanism analysis: Investigate the potential redundancy between SEC22a and YKT6, as their functions overlap in yeast . Design experiments with dual knockdown/knockout of both SEC22a and YKT6 to test functional redundancy.

  • Organism-specific autophagy initiation structures: Different autophagic initiation structures may determine whether SEC22a is required for autophagy. In yeast, autophagosomes are generated from the phagophore assembly site, which has not been identified in flies and mammalian cells .

  • Conditional knockout approaches: Use temporally controlled knockout systems to distinguish between developmental and acute effects of SEC22a deficiency on autophagy.

  • Quantitative proteomics: Apply stable isotope labeling with amino acids in cell culture (SILAC) to:

    • Compare autophagosome composition in the presence and absence of SEC22a

    • Identify compensatory changes in other trafficking proteins

    • Measure the relative abundance of SEC22a vs. YKT6 across different organisms and conditions

  • Advanced imaging techniques:

    • Super-resolution microscopy to visualize SEC22a localization during autophagy induction

    • Live-cell imaging with fluorescently tagged SEC22a and autophagy markers to track dynamic interactions

Experimental ApproachKey MeasurementsControlsExpected Outcome if SEC22a InvolvedExpected Outcome if Redundant
Dual KO (SEC22a/YKT6)Autophagosome formation, LC3 lipidationSingle KO of each geneSevere autophagy defectsMinimal effect in single KO, significant in double KO
Conditional KOTemporal analysis of autophagy fluxWild-type and constitutive KOTime-dependent autophagy defectsNo significant difference
Cross-species complementationRescue experiments with orthologsEmpty vector controlsSpecies-specific rescue patternsUniversal rescue capabilities
ER morphology assessmentER structure in SEC22a-deficient cellsWild-type controlsAltered ER morphology without autophagy defectsNormal ER morphology

How does SEC22a deficiency affect ER morphology independently of autophagy function?

SEC22a deficiency has been found to dramatically alter ER morphology without affecting autophagosome formation. In SEC22 mutants, the ER becomes highly proliferated with expanded lumens and altered morphology . This phenotype suggests that the role of SEC22a in maintaining ER morphology is separable from any potential function in autophagy.

The molecular mechanism behind this morphological change involves disrupted trafficking between the ER and Golgi mediated by SEC22a and Syntaxin 5 (Syx5). When either SNARE protein is lost, ER expansion occurs, indicating that failure in ER-Golgi trafficking triggers compensatory ER proliferation .

To investigate this phenomenon, researchers should:

  • Employ high-resolution electron microscopy to characterize the ultrastructural changes in the ER

  • Use live-cell imaging with ER markers to track dynamic changes in ER morphology following SEC22a depletion

  • Perform rescue experiments with:

    • Wild-type SEC22a

    • SEC22a mutants lacking specific domains

    • Other SEC22 family members

  • Analyze the lipid composition of expanded ER membranes to identify potential alterations in membrane properties

  • Investigate changes in ER stress markers and the unfolded protein response pathway, which might be activated as a consequence of altered ER morphology

These approaches will help distinguish between direct effects of SEC22a on ER structure versus indirect consequences of disrupted vesicular trafficking.

What are the optimal conditions for expressing and purifying recombinant Rat SEC22a for structural studies?

For structural studies of recombinant Rat SEC22a, optimizing expression and purification conditions is critical to obtain properly folded, functional protein in sufficient quantities. The following methodological approach is recommended:

ParameterOptimal ConditionRationaleNotes
Expression systemE. coli BL21(DE3)High yield, suitable for structural studiesFor full-length protein including transmembrane domain, consider C41(DE3) or C43(DE3) strains
Expression vectorpET28a with N-terminal His-tagFacilitates purification while minimizing interference with SNARE domainTEV protease cleavage site recommended between tag and protein
Induction0.5 mM IPTG at OD600 = 0.6-0.8Balances yield with proper foldingReduce to 0.1 mM IPTG and 18°C for transmembrane-containing constructs
Lysis buffer50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole, 1 mM DTTMaintains protein stability while allowing His-tag bindingAdd 0.5% n-dodecyl-β-D-maltoside (DDM) for full-length protein
PurificationTwo-step: IMAC followed by SECRemoves contaminants and aggregatesMonoQ ion exchange may be added for higher purity
Storage20 mM HEPES pH 7.5, 150 mM NaCl, 1 mM DTTMaintains stability for structural studiesAdd 10% glycerol for cryostorage

For structural studies specifically:

  • For crystallography: Concentrate to 10-15 mg/mL and screen with commercial crystallization kits

  • For NMR studies: Express in minimal media with 15N/13C labeling

  • For cryo-EM: Apply to freshly glow-discharged grids at 3-5 mg/mL

The SNARE domain (residues 33-95) can be expressed separately for interaction studies, while the full-length protein is necessary for understanding transmembrane domain contributions to homodimerization and membrane fusion .

How can researchers effectively analyze SEC22a homodimer formation in cellular membranes?

To analyze SEC22a homodimer formation in cellular membranes, researchers should employ a multi-faceted approach combining biochemical and imaging techniques:

  • Cysteine cross-linking strategy: Following the methodology described in search result , researchers can generate cysteine substitutions at strategic positions in the SEC22a sequence, particularly in the SNARE motif and C-terminus of the transmembrane domain. Upon oxidation, disulfide bonds will form between proximal cysteine residues if homodimers are present.

Key protocol steps:

  • Generate single-cysteine SEC22a mutants at multiple positions

  • Express in appropriate cell systems (mammalian or yeast)

  • Induce oxidation with copper phenanthroline

  • Analyze using non-reducing SDS-PAGE followed by western blotting

  • Compare results with reducing conditions to confirm specificity

  • Fluorescence resonance energy transfer (FRET):

  • Create SEC22a fusion constructs with donor (CFP) and acceptor (YFP) fluorophores

  • Co-express in cells and measure FRET efficiency using acceptor photobleaching

  • Calculate proximity based on FRET efficiency

  • Bimolecular fluorescence complementation (BiFC):

  • Split a fluorescent protein (Venus) into non-fluorescent fragments

  • Fuse each fragment to SEC22a

  • Upon dimerization, the fragments reconstitute fluorescence

  • In situ proximity ligation assay (PLA):

  • Use antibodies against SEC22a epitope tags

  • PLA signal indicates proteins in close proximity (<40 nm)

  • Quantify signals per cell to measure relative abundance of homodimers

  • Trans-SNARE complex analysis:
    Researchers can distinguish between trans- and cis-SNARE arrangements by:

  • Reconstituting SEC22a cysteine mutants into donor vesicles and acceptor membranes

  • Monitoring disulfide cross-link formation during in vitro fusion assays

  • Correlating homodimer formation with fusion efficiency

This multi-method approach provides complementary data to confirm the presence, dynamics, and functional significance of SEC22a homodimers in membrane trafficking.

What experimental design is optimal for investigating SEC22a interactions with other SNARE proteins?

To comprehensively investigate SEC22a interactions with other SNARE proteins, a systematic experimental design combining in vitro, cellular, and in vivo approaches is recommended:

  • In vitro binding assays:

    • Pull-down assays using recombinant proteins to determine direct interactions

    • Surface plasmon resonance (SPR) to measure binding kinetics and affinities

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

    • SNARE complex assembly assays using purified components

  • Cellular interaction studies:

    • Co-immunoprecipitation experiments in relevant cell types

    • Proximity-based labeling approaches (BioID or APEX2) to identify interaction partners in their native environment

    • FRET-based sensors to monitor interactions in real-time

    • Subcellular fractionation to determine compartment-specific interactions

  • Functional assays:

    • In vitro liposome fusion assays with reconstituted SEC22a and partner SNAREs

    • Cell-based trafficking assays measuring cargo transport between ER and Golgi

    • ER morphology analysis in cells expressing SEC22a mutants defective in specific interactions

  • Structural biology approaches:

    • X-ray crystallography or cryo-EM of SEC22a in complex with partner SNAREs

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map interaction interfaces

    • NMR spectroscopy to detect conformational changes upon binding

  • Genetic interaction screens:

    • CRISPR-based synthetic lethality screens to identify functional redundancies

    • Suppressor screens to identify compensatory pathways

Interaction PartnerMethodKey ControlsExpected OutcomeFunctional Validation
Syntaxin 5 (Syx5)Co-IP from ER/Golgi fractionsIP with IgG; SEC22a-depleted cellsDetection of SEC22a-Syx5 complex ER morphology assessment in Syx5 knockdown cells
Bet1In vitro binding with purified proteinsGST control; SNARE domain mutantsSEC22a-Bet1 heterodimer formation Cargo trafficking assays
Ykt6BioID proximity labelingBioID-only controlIdentification of transient interactionsDual knockdown phenotypic analysis
SEC22a (homodimer)Cysteine cross-linkingReducing conditions controlPosition-dependent homodimerization Correlation with fusion efficiency

This comprehensive experimental design will provide insights into both the physical interactions and functional significance of SEC22a-SNARE complexes in membrane trafficking.

How should researchers interpret contradictory results between SEC22a knockout and knockdown experiments?

When confronted with contradictory results between SEC22a knockout and knockdown experiments, researchers should consider several factors that might explain the discrepancies:

  • Compensatory mechanisms: Complete knockout may trigger compensatory upregulation of functionally related proteins like YKT6, which has overlapping functions with SEC22 . This compensation might not occur in partial knockdown.

  • Developmental versus acute effects: Constitutive knockout affects the organism throughout development, potentially triggering adaptive responses. In contrast, acute knockdown affects only mature cells, revealing immediate requirements.

  • Knockdown efficiency and specificity: Incomplete knockdown may leave sufficient SEC22a to fulfill essential functions, creating false negatives. Additionally, off-target effects of RNAi can lead to phenotypes unrelated to SEC22a deficiency.

  • Context-dependent functions: SEC22a may have different roles depending on cell type, developmental stage, or physiological conditions. For example, while Sec22 is dispensable for starvation-induced autophagy in flies , it might be required under different stress conditions.

To resolve these contradictions, implement the following methodological approaches:

ApproachMethodControlsAnalysis
Validate knockdown/knockoutqPCR, western blot, immunofluorescenceWild-type samples, housekeeping genesQuantify protein and mRNA reduction
Assess compensationRNA-seq or proteomics analysisTime-course following SEC22a depletionIdentify upregulated related proteins
Rescue experimentsReintroduce SEC22a or related proteinsEmpty vector, unrelated proteinDetermine specificity of the phenotype
Temporal controlInducible knockout systemsPre- and post-induction samplesDistinguish developmental from acute effects
Cell-type specific analysisTissue-specific Cre-lox systemsCre-negative tissuesIdentify context-dependent requirements

By systematically addressing these factors, researchers can determine whether contradictory results reflect biological reality (e.g., redundancy, context-specificity) or technical limitations of the experimental approaches.

What are the most common technical challenges in studying SEC22a and how can they be overcome?

Studying SEC22a presents several technical challenges due to its membrane association, involvement in complex protein interactions, and potential functional redundancy. Here are the most common challenges and strategies to overcome them:

  • Protein solubility and purification

Challenge: SEC22a contains a transmembrane domain, making it difficult to purify in a functional, soluble form.

Solutions:

  • Express truncated versions lacking the transmembrane domain for initial studies

  • Use mild detergents like DDM or CHAPS for full-length protein

  • Consider nanodiscs or amphipols for maintaining native-like membrane environment

  • Implement on-column detergent exchange during purification

  • Distinguishing specific interactions from non-specific membrane associations

Challenge: Membrane proteins often show non-specific interactions in pull-down assays.

Solutions:

  • Include stringent controls with unrelated membrane proteins

  • Perform crosslinking prior to solubilization

  • Use proximity labeling techniques (BioID, APEX) in intact cells

  • Validate interactions through multiple independent methods

  • Functional redundancy with other SNAREs

Challenge: Redundancy with proteins like YKT6 can mask phenotypes in single knockdown/knockout experiments .

Solutions:

  • Design combinatorial knockout/knockdown experiments

  • Use acute, inducible depletion systems

  • Employ domain-specific dominant-negative approaches

  • Develop assays sensitive enough to detect partial defects

  • Visualizing transient SNARE complexes

Challenge: SNARE complex assembly and disassembly are dynamic processes difficult to capture.

Solutions:

  • Use stabilized mutants that trap complexes at specific stages

  • Implement super-resolution live imaging with optimized fluorophores

  • Develop FRET-based sensors that report on complex formation

  • Apply single-molecule techniques to track individual complex formation events

  • Quantifying membrane fusion events

Challenge: Measuring the specific contribution of SEC22a to membrane fusion is technically challenging.

Solutions:

  • Reconstitute minimal fusion systems with fluorescent lipid mixing assays

  • Develop content mixing assays to distinguish hemifusion from complete fusion

  • Use cargo trafficking assays with quantifiable reporters

  • Implement live-cell imaging with SEC22a tagged at sites that don't interfere with function

By addressing these technical challenges with appropriate methodological approaches, researchers can generate more reliable and interpretable data on SEC22a function in membrane trafficking.

What emerging technologies show promise for advancing SEC22a research?

Several cutting-edge technologies are poised to significantly advance our understanding of SEC22a function and regulation:

  • Cryo-electron tomography (cryo-ET)
    This technique allows visualization of SEC22a-containing complexes in their native cellular environment at near-atomic resolution. It will enable researchers to observe the three-dimensional organization of SNARE complexes during different stages of membrane fusion, providing unprecedented insights into how SEC22a homodimers transition into heteromeric fusion complexes.

  • Genome editing with base editors and prime editors
    These precise gene editing tools allow introduction of specific mutations without creating double-strand breaks. Researchers can engineer endogenous SEC22a with subtle modifications to study structure-function relationships without overexpression artifacts. This approach is particularly valuable for introducing mutations in the transmembrane domain that affects homodimerization .

  • Optogenetic control of SNARE protein interactions
    Light-inducible dimerization systems can be adapted to control SEC22a interactions with temporal and spatial precision. This allows researchers to trigger specific interactions (e.g., SEC22a-Syntaxin 5 ) at defined locations within cells and observe the consequences for membrane trafficking and ER morphology.

  • Single-molecule tracking in living cells
    Super-resolution microscopy combined with protein tags like HaloTag or SNAP-tag enables tracking of individual SEC22a molecules within cells. This approach will reveal the dynamics of SEC22a movement between compartments, its residence time in SNARE complexes, and the kinetics of homodimer formation and dissociation.

  • In situ structural biology approaches
    Techniques like cryo-FIB milling combined with cryo-ET or in-cell NMR spectroscopy will allow determination of SEC22a structure in its native environment, including how transmembrane domain interactions contribute to homodimerization and membrane fusion .

  • Proximity proteomics with temporal resolution
    Advanced proximity labeling approaches like TurboID or split-TurboID with temporal control will help identify the dynamic interactome of SEC22a during different stages of vesicle trafficking, potentially revealing new regulatory partners.

These technologies, especially when used in combination, promise to resolve current contradictions in the field and provide a comprehensive understanding of SEC22a function in membrane trafficking and ER morphology regulation.

How might research on SEC22a contribute to understanding neurodegenerative diseases?

SEC22a's role in maintaining proper ER morphology and vesicular trafficking positions it as a potentially important factor in neurodegenerative diseases, which often involve ER stress and defective membrane trafficking. Research on SEC22a could contribute to our understanding of these diseases in several ways:

  • ER stress and the unfolded protein response (UPR)
    SEC22a deficiency leads to dramatic changes in ER morphology , which could potentially trigger ER stress. Many neurodegenerative diseases, including Alzheimer's, Parkinson's, and ALS, feature chronic ER stress and UPR activation. Investigating how SEC22a maintains normal ER structure could reveal mechanisms to prevent pathological ER stress.

  • Protein trafficking defects
    Proper trafficking of proteins between the ER and Golgi is essential for neuronal function. SEC22a-mediated transport ensures correct processing and localization of numerous neuronal proteins, including receptors and ion channels. Dysfunction in this pathway could contribute to protein mislocalization observed in neurodegenerative conditions.

  • Synaptic vesicle recycling
    While SEC22a's role in neurons remains to be fully characterized, SNARE proteins are critical for synaptic vesicle fusion and recycling. Investigating SEC22a function in neurons might reveal specialized roles in synaptic maintenance or plasticity, processes frequently disrupted in neurodegeneration.

  • Interaction with disease-associated proteins
    Research could explore potential interactions between SEC22a and known neurodegenerative disease-associated proteins. For example, investigating whether SEC22a trafficking is affected by presenilin mutations (Alzheimer's) or α-synuclein aggregates (Parkinson's) could reveal new disease mechanisms.

  • Therapeutic targeting
    Understanding SEC22a function could lead to novel therapeutic approaches:

    • Small molecules that modulate SEC22a homodimerization might regulate ER stress responses

    • Gene therapy approaches to normalize SEC22a expression in affected neurons

    • Targeting SEC22a-interaction partners to restore proper trafficking in disease states

To advance this research direction, investigators should:

  • Develop neuron-specific SEC22a knockout mouse models

  • Examine SEC22a expression and localization in post-mortem brain tissue from neurodegenerative disease patients

  • Screen for genetic variations in SEC22A associated with disease risk

  • Investigate whether SEC22a trafficking is affected by protein aggregates characteristic of different neurodegenerative diseases

This research could ultimately reveal new therapeutic targets and biomarkers for early detection of trafficking defects preceding neurodegeneration.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.