Recombinant Rat Vesicle transport protein SFT2B (Sft2d2)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The protein is expressed in E. coli systems, followed by affinity chromatography using the His-tag. Reconstitution protocols recommend:

  • Centrifugation before resuspension in sterile water (0.1–1.0 mg/mL).

  • Addition of 5–50% glycerol for long-term storage .

Functional Insights

SFT2D2 facilitates retrograde transport vesicle fusion with the Golgi complex, enabling cargo recycling and organelle maintenance . Key functional roles include:

  • Vesicle Trafficking: Mediates interactions between vesicles and molecular motors (e.g., kinesins, dyneins) via FRB/FKBP domain assays .

  • Membrane Dynamics: Regulates SNARE complex assembly, critical for vesicle docking and fusion .

4.1. Vesicle Trafficking Studies

  • Used in assays to map interactions between trafficking proteins and vesicles via rapamycin-inducible FRB/FKBP systems .

  • Identified in gene expression profiling of rat intestine under vitamin D regulation, suggesting roles in nutrient transport .

4.2. Antibody Validation

  • Validated in Western blot (WB) and immunofluorescence (IF) using antibodies like ab236899 (Abcam) and PACO29860 (Assay Genie) .

    • WB Results: Detected in mouse liver, kidney, and thymus tissues at ~18 kDa .

    • IF Localization: Observed in Golgi-associated compartments .

4.3. Disease Models

  • Studied in rat pre-implantation embryos to understand oxidative stress and apoptosis during developmental arrest .

Key Challenges and Considerations

  • Stability: Requires strict adherence to storage protocols (-80°C) to prevent aggregation .

  • Species Cross-Reactivity: Antibodies show high homology (97%) between rat, mouse, and human orthologs .

Future Directions

  • Mechanistic Studies: Elucidate interactions with Rab GTPases or SNARE proteins using cryo-EM .

  • Therapeutic Targeting: Explore links to neurodegenerative diseases involving vesicle transport defects .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during production. If a particular tag is required, please specify it in your order; we will prioritize its use.
Synonyms
Sft2d2; Vesicle transport protein SFT2B; SFT2 domain-containing protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-157
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Sft2d2
Target Protein Sequence
MDKLKKVLSGQDTEDRSGLSEVVESSSLSWSTRIKGFIVCFALGILCSLLGTLLLWVSRK GLFAVFYTLGNITSIGSTMFLMGPLKQLKRMFEPTRLIATILVLLFFVLTLCSAFLWNKG LALIFCILQSLALTWYSLSYIPYARDAVKKCFAVCLT
Uniprot No.

Target Background

Function
This protein may be involved in the fusion of retrograde transport vesicles originating from an endocytic compartment with the Golgi complex.
Database Links
Protein Families
SFT2 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What cellular functions does SFT2D2 participate in?

SFT2D2, also known as Vesicle-trafficking protein SEC34 homolog, plays crucial roles in membrane dynamics and intracellular transport. Specifically, the protein:

  • Regulates vesicle fusion events in intracellular trafficking pathways

  • Contributes to protein secretion mechanisms

  • Participates in organelle biogenesis and maintenance

  • Functions within membrane fusion processes

These functions make SFT2D2 an important component of the cellular machinery that ensures proper protein transport and organelle function . The protein's transmembrane structure allows it to integrate into vesicular membranes and facilitate fusion events that are essential for cellular homeostasis.

What expression systems are optimal for producing recombinant rat SFT2D2?

E. coli is the most commonly used expression system for recombinant rat SFT2D2 protein production as documented in the literature. When expressing the full-length protein (1-157aa), an N-terminal His tag is frequently utilized to facilitate purification .

For optimal expression and purification:

  • Use a strain optimized for membrane protein expression (e.g., C41(DE3) or C43(DE3))

  • Consider lower induction temperatures (16-25°C) to improve proper folding

  • Include mild detergents during lysis and purification steps to maintain protein solubility

  • Purify using nickel affinity chromatography leveraging the His tag

  • Verify protein integrity by SDS-PAGE (expected molecular weight ~18 kDa including the tag)

The final purified product typically achieves >90% purity as determined by SDS-PAGE analysis .

What are the optimal storage conditions for recombinant SFT2D2 protein?

For maintaining recombinant SFT2D2 protein stability and activity:

Storage ParameterRecommended ConditionNotes
Long-term storage-20°C to -80°CAliquoting is necessary to avoid repeated freeze-thaw cycles
Buffer compositionTris/PBS-based buffer, pH 8.0 with 6% TrehaloseTrehalose serves as a cryoprotectant
Glycerol addition5-50% (final concentration)50% is commonly used for long-term storage
Working stocks4°CStable for up to one week
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mLReconstitute immediately before use

Importantly, repeated freeze-thaw cycles significantly reduce protein activity and should be avoided. After reconstitution, the protein should be used promptly or stored with glycerol at recommended temperatures .

How can researchers effectively detect SFT2D2 in experimental samples?

Multiple validated approaches exist for detecting SFT2D2 in biological samples:

  • Western Blot Analysis:

    • Use polyclonal antibodies against SFT2D2 at dilutions of 1:1000-1:5000

    • Recommended for protein expression quantification in cell and tissue lysates

    • Detection typically requires ECL or fluorescent secondary antibodies

  • Immunofluorescence:

    • Optimal antibody dilutions range from 1:50-1:200

    • Validated in human cell lines including MCF-7

    • Allows visualization of subcellular localization

  • ELISA-based Detection:

    • Particularly useful for detecting anti-SFT2D2 autoantibodies

    • In-house ELISA systems have been developed using synthetic peptide fragments

    • Typically utilizes the N-terminal linear peptide (KLKKVLSGQDTEDRSGLSEVVEAS) as antigen

When selecting detection methods, researchers should consider the sensitivity requirements, available sample quantities, and whether qualitative or quantitative data is needed.

What experimental controls should be included when studying SFT2D2?

Robust experimental design for SFT2D2 studies should include:

  • Positive Controls:

    • Cell lines with confirmed SFT2D2 expression (e.g., MCF-7 cells for human studies)

    • Recombinant SFT2D2 protein for antibody validation

    • Known positive samples for autoantibody detection assays

  • Negative Controls:

    • SFT2D2 knockdown or knockout samples

    • Secondary antibody-only controls for immunodetection

    • Blocking peptide controls to confirm antibody specificity

    • Samples from healthy individuals for autoantibody studies

  • Technical Quality Controls:

    • Duplicate or triplicate testing for all samples

    • Inclusion of loading controls (e.g., GAPDH, β-actin) for Western blotting

    • Calculation of specific binding ratios for ELISA results

    • Genotype verification when studying SFT2D2 variants

Implementation of these controls ensures data reliability and facilitates accurate interpretation of experimental results.

What is the evidence linking SFT2D2 to schizophrenia pathology?

Recent research has established compelling connections between SFT2D2 and schizophrenia:

  • Genetic Association:

    • A rare variant (rs532193193) in the SFT2D2 locus shows strong association with schizophrenia

    • The variant was identified through re-genotyping analysis of the 1q24-25 region in 9,801 case-control subjects of Chinese Han origin

    • This variant exhibits linkage disequilibrium with previously identified GWAS index SNPs (rs10489202, rs11586522, and rs6670165)

  • Autoimmune Component:

    • Patients with schizophrenia demonstrate significantly elevated anti-SFT2D2 IgG levels compared to control subjects

    • ROC analysis revealed an area under the curve (AUC) of 0.803 for anti-SFT2D2 IgG assay

    • The assay showed 28.57% sensitivity against 95% specificity, suggesting potential diagnostic value

These findings suggest that SFT2D2 may play a role in the autoimmune pathological mechanisms underlying schizophrenia, particularly supporting the growing evidence for immune system involvement in psychiatric disorders.

How can researchers assess anti-SFT2D2 autoantibodies in clinical samples?

For detecting anti-SFT2D2 autoantibodies in patient samples:

  • ELISA Protocol:

    • Synthetic peptide approach: Use the N-terminal linear peptide of SFT2D2 (KLKKVLSGQDTEDRSGLSEVVEAS) as antigen

    • This peptide region was identified through computational prediction of HLA-II restricted epitopes using the Immune Epitope Database

    • Dilute peptide to 10 μg/ml in appropriate coating buffer (0.1 M phosphate buffer with 0.15 M NaCl and 1 mM EDTA)

    • Develop with 3,3′,5,5′-tetramethylbenzidine (TMB) substrate

    • Measure optical density at 450 nm with a reference wavelength of 620 nm

  • Data Analysis:

    • Calculate specific binding ratio (SBR) for each sample

    • Use Mann-Whitney U-test to examine differences in plasma anti-SFT2D2 IgG levels between groups

    • Apply ROC analysis to determine sensitivity and specificity

    • Consider applying a cutoff corresponding to ≥95% specificity for clinical relevance

This methodology has been validated in studies involving hundreds of plasma samples and provides a reliable approach for investigating the potential role of SFT2D2 autoimmunity in various disorders.

How should researchers design experiments to investigate SFT2D2 function in vesicle trafficking?

When designing experiments to investigate SFT2D2's role in vesicle trafficking:

  • Cell Model Selection:

    • Choose cell types with well-characterized vesicular trafficking systems

    • Consider neuronal cells for schizophrenia-related studies

    • Use cells with endogenous SFT2D2 expression or stable transfection models

  • Functional Assays:

    • Vesicle fusion assays using fluorescently labeled membrane components

    • Co-localization studies with established vesicle markers

    • Protein secretion assays measuring transport of cargo proteins

    • Live-cell imaging to track vesicle movement in real-time

  • Gene Manipulation Approaches:

    • CRISPR/Cas9-mediated knockout of SFT2D2

    • RNA interference for transient knockdown

    • Expression of dominant-negative mutants

    • Rescue experiments with wild-type protein

  • Critical Controls:

    • Include both gain- and loss-of-function approaches

    • Compare effects of mutant vs. wild-type SFT2D2

    • Measure multiple vesicle trafficking parameters simultaneously

    • Account for batch effects in experimental design

When analyzing results, researchers should quantify multiple parameters of vesicle dynamics to comprehensively assess SFT2D2's functional impact.

What are the key considerations for studying the relationship between SFT2D2 variants and autoimmune responses?

For investigating connections between SFT2D2 genetic variants and autoimmune responses:

  • Study Design Principles:

    • Implement case-control designs with adequate statistical power

    • Include at least 3 biological replicates per condition

    • Avoid confounding by carefully distributing sample groups across experimental batches

    • Consider ethnic differences in genetic architecture (e.g., differences observed between European and East Asian populations)

  • Sequential Analysis Strategy:

    • Identify disease-associated haplotypes first

    • Perform deep sequencing of regions surrounding index SNPs

    • Verify potential causal variants in large mixed case-control samples

    • Validate findings in independent populations

  • Autoimmune Response Assessment:

    • Develop epitope-specific antibody detection methods

    • Consider both linear and conformational epitopes

    • Test multiple patient populations to account for heterogeneity

    • Include longitudinal sampling where possible to assess temporal dynamics

  • Data Integration Approaches:

    • Correlate genetic variants with antibody response metrics

    • Apply ROC analysis to determine diagnostic potential

    • Investigate genotype-phenotype relationships

    • Use bioinformatics to predict structural and functional consequences of variants

This comprehensive approach ensures robust investigation of the complex relationship between genetic variation in SFT2D2 and associated autoimmune phenomena.

How might SFT2D2 function connect vesicle trafficking to neuropsychiatric disorders?

The emerging connection between SFT2D2 and neuropsychiatric disorders suggests several potential mechanistic links:

  • Synaptic Function Hypothesis:

    • SFT2D2 may regulate vesicular release of neurotransmitters

    • Dysfunction could alter synaptic transmission efficiency

    • This might contribute to neuronal communication abnormalities observed in schizophrenia

  • Immune-Neuronal Interface:

    • Autoantibodies against SFT2D2 could disrupt normal protein function

    • This may represent a novel neuroimmune mechanism in schizophrenia pathogenesis

    • ROC analysis showing AUC of 0.803 for anti-SFT2D2 IgG supports this connection

  • Developmental Considerations:

    • SFT2D2 dysfunction during neurodevelopment might affect neuronal migration or connectivity

    • Early disruption of vesicular trafficking could have long-term consequences for brain circuit formation

    • This aligns with neurodevelopmental theories of schizophrenia

  • Therapeutic Implications:

    • SFT2D2 could represent a novel therapeutic target

    • Immunomodulatory approaches might benefit patients with elevated anti-SFT2D2 antibodies

    • Early detection of anti-SFT2D2 antibodies might enable intervention before symptom onset

Future research should explore these hypothetical mechanisms by combining neurobiological, immunological, and genetic approaches to comprehensively understand SFT2D2's role in neuropsychiatric pathophysiology.

What methodological advances would enhance SFT2D2 research?

Several methodological innovations could significantly advance SFT2D2 research:

  • Improved Protein Expression Systems:

    • Development of mammalian expression systems that better preserve post-translational modifications

    • Nanodiscs or liposome reconstitution methods to maintain native membrane protein conformation

    • Cell-free expression systems for rapid production of functional protein variants

  • Advanced Imaging Techniques:

    • Super-resolution microscopy to visualize SFT2D2 in vesicular structures

    • Live-cell FRET-based assays to monitor protein-protein interactions

    • Correlative light and electron microscopy to link function with ultrastructure

  • High-Throughput Variant Analysis:

    • Massively parallel reporter assays to assess functional consequences of multiple SFT2D2 variants

    • CRISPR base editing for precise introduction of disease-associated variants

    • Single-cell RNA-seq to measure effects of variants on transcriptional networks

  • Refined Immunoassays:

    • Development of high-sensitivity, epitope-specific detection methods

    • Multiplex assays to simultaneously measure multiple autoantibodies

    • Automated image analysis for quantitative immunofluorescence

    • Advanced ROC analysis with machine learning to improve diagnostic accuracy

Implementation of these methodological advances would accelerate understanding of SFT2D2 biology and its role in health and disease.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.