Recombinant Rat Vezatin (Vezt)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional fees.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Vezt; Vezatin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-782
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Vezt
Target Protein Sequence
MTPEFDEEVVFENSPLYQYLQDLGHTDFEICSSLSPKTETCLTTEEPQTPPTRVLQKQGI LLKLTETIKSWTLSSQYSKKDDLLHKLDTGFRLDALDAILQQEVLLQEDVELIELLDPSI LSAGHPQQENGHLPTLCSLATPNIWDVSMLFAFISLLIMLPTWWIVSSWLVWGIILFLYL IIRVLKFWRTAKLQMTLKKYRVRLEDMAANSRAFTNLVRKSLRLIQETEVISRGFTLLLD RVSAACSFNKAAQHPSQHLIGLRKAVYRTVRANFQAARLATLYMLKNYPLNSESDNVTNY ICVVPFKELGLGLSEDQISEEEARNLTDGFSLPALKVLFQLWVAQSSEFFRRLALLLSTA NSPSGPLLTAALLPHRILSDVTQGLPHAHTACLDELKRSYEFFRYFETQHQSVPQRLPKT QPKWRELNNVHTAVRSLQLHLKALLNEVIILEDELEKLVCTKETQELLSEAYPVLEQRLK LIEPHVQASNSCWEEAISQVDRLLRRNTDQKGKPGVACENPHCTAAPLLRPTLHIEDRDP IPEEQELEAYVDGIDIESEFRKDSLYHVSQEDRERQKREQEESKRVLQELKSVLGFKASE AERQKWKQLLFSDHAVLKSLSPVEPVESVSNSETPMNSDTEQAHSEATEEETSKPCASDK EDTRTEYMCDGPPKGQSKDTSGDQGHLLQGAHQCESEAKPPQAAAAGATAPPTPRDSPRL SIKQRLARLQLSPEYTFTAGLAAEVAARSLSFTTMQEQTFGDEEDEDKEQLVEGGERELE EK
Uniprot No.

Target Background

Function
Recombinant Rat Vezatin (Vezt) plays a crucial role in establishing and maintaining adherens junctions throughout life. It is essential for preimplantation embryo morphogenesis and the implantation process.
Database Links
Protein Families
Vezatin family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell projection, stereocilium membrane. Cell junction, adherens junction. Nucleus. Cytoplasmic vesicle, secretory vesicle, acrosome.

Q&A

What is Vezatin and what are its primary functions in rat neural tissue?

Vezatin is an integral membrane protein that associates with cell-cell adhesion complexes and the actin cytoskeleton. In rat neural tissue, Vezatin localizes in spines of mature hippocampal neurons and codistributes with PSD95, a major scaffolding protein of the excitatory postsynaptic density. The protein is expressed in both developing and mature mammalian brain .

Functionally, Vezatin plays critical roles in:

  • Dendritic spine morphogenesis (affecting spine shape and maturation)

  • Functional synaptic maturation (influencing the AMPA/NMDA ratio of evoked EPSCs)

  • Behavioral responses (conditional ablation induces anxiety-like behavior and impairs cued fear-conditioning memory)

Studies have shown that Vezatin knock-down or conditional knock-out leads to a significantly increased proportion of stubby spines and a reduced proportion of mature dendritic spines, suggesting its importance in neuronal morphology and function .

How is recombinant Rat Vezatin typically produced?

Based on methodologies used for other rat proteins, recombinant Rat Vezatin production typically involves several key steps:

  • Gene isolation: The Vezatin gene can be isolated through screening of a rat cDNA library using appropriate probes (similar to the approach used for rat DHFR gene isolation) .

  • Vector construction: The isolated gene is cloned into an appropriate expression vector. For example, the gene could be inserted into a vector containing bacteriophage recombination sites (such as attB/attP) and a protease recognition site (such as TEV protease site) .

  • Expression system transformation: The constructed vector is introduced into an expression system, commonly E. coli strains like BL21(λDE3) .

  • Protein expression: Expression is induced under appropriate conditions, and cells are harvested and lysed.

  • Purification: Various chromatography techniques can be applied, potentially including affinity chromatography (if tag systems like GST fusion are used), followed by additional purification steps such as gel filtration .

What analytical methods should be used to verify recombinant Rat Vezatin quality and function?

Several complementary methods should be employed:

Analytical MethodPurposeKey Parameters
SDS-PAGEPurity assessment and molecular weight confirmationTypically run on 10-12% gels; expect a band at ~87 kDa
Western blottingIdentity confirmationUse validated anti-Vezatin antibodies; infrared imaging systems like Odyssey can provide quantification
Mass spectrometryProtein identification and modification analysisUseful for confirming sequence and detecting PTMs
Circular dichroismSecondary structure assessmentParticularly important to confirm proper folding
Size exclusion chromatographyOligomeric state assessmentCan detect aggregation or oligomerization
Activity assaysFunctional verificationBinding assays with known partners like actin or adhesion proteins

For quantification of western blots, systems like the Odyssey infrared imaging system have been used successfully with Vezatin studies . Protein samples should be normalized using housekeeping proteins like β-tubulin or GAPDH.

What are the challenges in expressing full-length functional Rat Vezatin?

Expressing full-length Vezatin presents several challenges:

  • Membrane protein solubility: As an integral membrane protein, Vezatin contains hydrophobic domains that can cause aggregation during expression and purification.

  • Post-translational modifications: Native Vezatin undergoes modifications that may be essential for function but difficult to replicate in bacterial systems.

  • Proper folding: The complex structure of Vezatin requires appropriate chaperone systems that may be lacking in heterologous expression hosts.

  • Domain interactions: The functional interactions between different domains of Vezatin may be disrupted in recombinant systems.

Potential solutions include using expression systems that better accommodate membrane proteins (such as insect cells), adding solubility tags, optimizing buffer conditions, or expressing functional domains separately rather than the full-length protein.

How can recombinant Rat Vezatin be used to study its role in dendritic spine morphogenesis?

Recombinant Rat Vezatin can be a valuable tool for investigating spine morphogenesis through several approaches:

  • Rescue experiments: In neurons with Vezatin knockdown or from conditional knockout mice, introducing recombinant Vezatin can determine if spine morphology defects can be rescued. This approach has been informative in studies showing that Vezatin deficiency leads to increased stubby spines and reduced mature dendritic spines .

  • Structure-function studies: By creating recombinant Vezatin variants with specific domain mutations or deletions, researchers can identify which regions are critical for spine morphogenesis.

  • Protein interaction studies: Recombinant Vezatin can be used in pull-down assays to identify binding partners in dendritic spines, particularly those associated with actin cytoskeleton regulation.

  • Live imaging experiments: Fluorescently tagged recombinant Vezatin can be used to track its dynamics during spine formation and maturation in live neurons.

  • In vitro reconstitution: Purified recombinant Vezatin, along with other spine proteins, can be used in in vitro systems to recreate aspects of spine formation.

What methodological approaches can be used to study the interaction between Vezatin and PSD95?

Since Vezatin codistributes with PSD95 in dendritic spines , several methods can be employed to study this interaction:

  • Co-immunoprecipitation: Using either native tissue lysates or systems expressing recombinant proteins to pull down Vezatin and detect associated PSD95 (or vice versa).

  • Proximity ligation assays: Detecting in situ protein interactions in fixed neuronal cultures with specific antibodies against Vezatin and PSD95.

  • FRET/BRET analysis: Using fluorescently tagged recombinant proteins to detect direct interactions through resonance energy transfer techniques.

  • Surface plasmon resonance: Measuring direct binding kinetics between purified recombinant Vezatin and PSD95 domains.

  • Yeast two-hybrid screening: Identifying specific domains involved in the interaction.

  • Electrophysiological studies: Examining functional consequences of disrupting the interaction on AMPA/NMDA ratios, which have been shown to be affected by Vezatin deficiency .

What controls should be included in experiments using recombinant Rat Vezatin?

Proper experimental design requires several types of controls:

  • Negative controls:

    • Vehicle-only treatments in cell-based assays

    • Irrelevant proteins of similar size/structure in binding assays

    • Inactive mutant versions of Vezatin (e.g., with key binding sites mutated)

  • Positive controls:

    • Native Vezatin from rat brain extracts

    • Known Vezatin-interacting proteins in binding studies

    • Previously validated functional readouts

  • Expression/purification controls:

    • Tag-only protein to control for tag effects

    • Validation of protein folding and activity

  • Genetic background controls:

    • When using transgenic models, appropriate littermate controls should be used, similar to the approach in Vezatin conditional knockout studies

  • Antibody specificity controls:

    • Samples from Vezatin-null tissues or cells to confirm antibody specificity

How should researchers design experiments to study Vezatin's role in functional synaptic maturation?

Based on findings that Vezatin influences the AMPA/NMDA ratio of evoked EPSCs , comprehensive experimental designs should include:

  • Electrophysiological approaches:

    • Whole-cell patch-clamp recordings to measure AMPA/NMDA ratios

    • Analysis of miniature EPSCs (amplitude and frequency)

    • Paired-pulse facilitation to assess presynaptic function

  • Imaging approaches:

    • Quantification of synaptic protein distribution (PSD95, AMPA receptors, NMDA receptors)

    • Live imaging of receptor trafficking in the presence/absence of Vezatin

    • Super-resolution microscopy to examine nanoscale organization of synaptic components

  • Molecular manipulation:

    • Domain-specific mutations in recombinant Vezatin to identify regions critical for synaptic maturation

    • Temporal control of Vezatin expression/removal to determine critical periods

  • Behavioral correlates:

    • Testing learning and memory functions, which may be impaired given Vezatin's role in fear conditioning

What cloning strategies are most effective for Rat Vezatin expression?

Based on successful approaches with other rat proteins, effective cloning strategies include:

  • Gateway cloning system: Using attB/attP recombination sites for efficient transfer between vectors, similar to approaches used for rat DHFR . This allows convenient transfer between different expression vectors without traditional restriction enzyme cloning.

  • Fusion protein approaches: Creating fusion constructs with solubility-enhancing partners like GST, with TEV protease recognition sites for subsequent tag removal .

  • Codon optimization: Adjusting codon usage to match the expression host for improved protein yield.

  • Signal sequence modification: For membrane proteins like Vezatin, optimizing signal sequences can improve membrane targeting or secretion.

  • Domain-based expression: Expressing functional domains separately may overcome challenges with full-length expression.

The PCR primers should be carefully designed to include appropriate recombination sites (like attB1/attB2), protease cleavage sites, and in-frame fusion with the target gene .

What purification strategies yield the highest purity recombinant Rat Vezatin?

A multi-step purification approach is recommended:

  • Initial capture: Affinity chromatography using fusion tags (GST, His, etc.) provides specific capture of the recombinant protein.

  • Tag removal: Proteolytic cleavage with specific proteases (like TEV) to remove fusion tags .

  • Secondary purification: Ion exchange chromatography to separate cleaved protein from contaminants based on charge differences.

  • Polishing step: Size exclusion chromatography (e.g., G-75 gel filtration) to remove aggregates and further increase purity .

  • Buffer optimization: Including appropriate stabilizers (DTT for reducing conditions, specific detergents for membrane proteins).

For membrane proteins like Vezatin, additional considerations include the use of appropriate detergents throughout the purification process to maintain solubility and native conformation.

How can researchers assess the functional activity of purified recombinant Rat Vezatin?

Several complementary approaches can be used:

  • Binding assays: Testing interaction with known binding partners such as components of adherens junctions and actin cytoskeleton.

  • Cellular assays: Introducing recombinant Vezatin into Vezatin-deficient neurons to assess rescue of phenotypes such as spine morphology abnormalities .

  • Structural integrity assessment: Using techniques like circular dichroism or limited proteolysis to confirm proper folding.

  • Cell adhesion assays: Since Vezatin is associated with cell-cell adhesion complexes , functional tests could include cellular aggregation or adhesion strength measurements.

  • Cytoskeletal interaction assays: As Vezatin interacts with the actin cytoskeleton , assays measuring actin polymerization or stabilization in the presence of recombinant Vezatin could be informative.

What biosafety considerations apply to research with recombinant Rat Vezatin?

When working with recombinant Rat Vezatin, researchers should follow established biosafety guidelines:

  • Regulatory framework: Research involving recombinant DNA should adhere to the NIH Guidelines for Research Involving Recombinant or Synthetic Nucleic Acid Molecules, which cover "recombinant nucleic acid molecules, synthetic nucleic acid molecules, and cells, organisms, and viruses containing such molecules" .

  • Institutional oversight: Work should be reviewed by an Institutional Biosafety Committee (IBC), which evaluates research proposals with biohazard potential and establishes containment requirements .

  • Risk assessment: Recombinant Rat Vezatin would likely fall under Risk Group 1 (RG-1), defined as "Agents not associated with disease in healthy adults" .

  • Animal studies: When using recombinant Vezatin in animal studies, approval from the Institutional Animal Care and Use Committee (IACUC) is required, following the Guide for the Care and Use of Laboratory Animals .

  • Laboratory practices: Standard good laboratory practices for recombinant protein work should be followed, including proper waste disposal and decontamination procedures.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.