Recombinant Rat Vitamin K epoxide reductase complex subunit 1-like protein 1 (Vkorc1l1)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Vitamin K Cycle

Vkorc1l1 operates as a vitamin K oxidoreductase, reducing vitamin K 2,3-epoxide (KO) to vitamin K hydroquinone (KH2), enabling γ-carboxylation of clotting factors and bone proteins . Distinctive features compared to VKORC1 include:

PropertyVKORC1VKORC1L1
Tissue ExpressionLiver-dominant Ubiquitous (adipocytes, VSMC)
Warfarin SensitivityHigh (Ki=1.65μMK_i = 1.65 \mu M) Low (Ki=32.6μMK_i = 32.6 \mu M)
Developmental RolePostnatal coagulation Prenatal compensation

Enzymatic Activity & Kinetics

  • Substrate Affinity:

    • KmK_m for KO: 35.0±3.0μM35.0 \pm 3.0 \mu M (rat)

    • Catalytic efficiency (kcat/Kmk_{cat}/K_m): 5-fold lower than VKORC1 .

  • Redox Partners: Requires dithiothreitol (DTT) or thioredoxin reductase for electron transfer .

In Vivo Functional Redundancy

  • Liver: Vkorc1l1 rescues lethal bleeding in Vkorc1/^{-/-} mice during embryogenesis but fails to sustain adult coagulation .

  • Bone: Compensates for VKORC1 deficiency in perinatal osteocalcin carboxylation (p<0.01p < 0.01) .

Antioxidant & Vascular Roles

  • VSMC Protection: Silencing Vkorc1l1 in human coronary artery SMCs:

    • ↑ ROS production (186.3% vs control, p=0.009p = 0.009)

    • ↑ NF-κB activation (2.12.1-fold, p<0.05p < 0.05)

    • ↑ IL-6 expression (1.81.8-fold, p=0.03p = 0.03)

  • ER Stress Modulation: Upregulates GRP78 during ER stress (p<0.01p < 0.01) .

Recombinant Protein Production

ParameterSpecification
Host SystemE. coli/Yeast/Mammalian
Purity≥85% (SDS-PAGE)
Storage-80°C in Tris/PBS + 6% trehalose

Disease Modeling

  • Warfarin Resistance: Partial activity retention at 10 μM warfarin .

  • Vascular Pathologies: Linked to neointima formation via ROS/NF-κB pathways .

Challenges & Future Directions

  1. Functional Overlap: Mechanisms enabling Vkorc1l1’s partial redundancy with VKORC1 remain unresolved .

  2. Therapeutic Targeting: Potential for designing warfarin-insensitive vitamin K reductases .

  3. Tissue-Specific Roles: Requires single-cell RNA-seq to map expression in non-hepatic tissues .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributor for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize the development of the specified tag.
Synonyms
Vkorc1l1; Vitamin K epoxide reductase complex subunit 1-like protein 1; VKORC1-like protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Vkorc1l1
Target Protein Sequence
MAAPVLLRVSVPRWERVARYAVCAAGILLSIYAYHVEREKERDPEHRALCDLGPWVKCSA ALASRWGRGFGLLGSIFGKDGVLNQPNSVFGLIFYILQLLLGMTASAVAALVLMTSSIVS VVGSLYLAYILYFVLKEFCIICVTTYVLNFLLLIINYKRLVYLNEAWKRQLQPKED
Uniprot No.

Target Background

Function
Vkorc1l1 (Vitamin K epoxide reductase complex subunit 1-like protein 1) is involved in vitamin K metabolism. It can reduce inactive vitamin K 2,3-epoxide to active vitamin K (in vitro) and may contribute to vitamin K-mediated protection against oxidative stress. Vkorc1l1 plays a role in vitamin K-dependent gamma-carboxylation of Glu residues in target proteins.
Database Links
Protein Families
VKOR family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Detected in lung, liver, testis, and at lower levels in kidney and brain.

Q&A

What is the evolutionary relationship between VKORC1 and VKORC1L1?

Phylogenetic evidence suggests that VKORC1 and VKORC1L1 paralogs arose earlier than gnathostomes (jawed vertebrates), possibly in the ancestor of crown chordates. Despite gene duplications typically resulting in the eventual loss of one copy, all jawed vertebrates have retained both VKOR genes throughout evolution, suggesting crucial biological roles for both enzymes. This evolutionary conservation appears to be driven by subfunctionalization - a process where duplicated genes evolve to perform specialized subsets of the ancestral gene's functions . Both VKORC1 and VKORC1L1 function as entry points for nutritionally acquired and recycled K vitamers in the vitamin K cycle, though they serve different physiological purposes .

How do the tissue-specific expression patterns of VKORC1 and VKORC1L1 differ?

VKORC1L1 exhibits relatively uniform expression across most tissues, with only a few showing significantly higher-than-median expression levels:

  • Adipocytes, CD34+ cell lines (including monocytic lines), and B lymphoblasts show elevated VKORC1L1 expression

  • Proteomics studies have detected VKORC1L1 in fetal brain, placenta, testes, and adult lung

  • Brain tissue shows higher-than-median VKORC1L1 protein expression based on MS studies

In contrast, VKORC1 shows more varied tissue expression:

  • Highest expression in liver (where vitamin K-dependent clotting factors are synthesized)

  • Also highly expressed in adipocytes, smooth muscle, thyroid, lung, and pineal body

  • Proteomics studies have detected VKORC1 in adrenal gland, monocytes, platelets, lung, ovary, and testes

This differential expression pattern supports distinct physiological roles for these paralogs.

What are the functional differences between VKORC1 and VKORC1L1?

VKORC1 and VKORC1L1 have evolved distinct biological roles:

VKORC1:

  • Critical for blood coagulation as demonstrated in knockout mice that typically died from internal hemorrhage due to severe deficiency of γ-glutamyl carboxylated clotting factors

  • Essential for proper bone formation, with VKORC1-deficient mice showing significantly shorter long bones compared to wild-type mice

  • Required for γ-glutamyl carboxylation of osteocalcin in osteoblast cells

VKORC1L1:

  • Cannot functionally substitute for VKORC1 in osteoblast cells

  • Promotes vitamin K-dependent cell viability and eliminates intracellular reactive oxygen species

  • Involved in adipogenesis, with deficiency leading to underdeveloped white adipose tissue and decreased plasma leptin

  • Influences vascular smooth muscle cell function and migration in vascular remodeling processes

These functional differences reflect the evolutionary subfunctionalization of these paralogs.

How does warfarin sensitivity differ between the VKORC1 and VKORC1L1 enzymes?

Warfarin sensitivity represents one of the most significant functional differences between these paralogs:

EnzymeWarfarin Inhibition Constant (Ki)Relative Sensitivity
Human VKORC1Baseline referenceStandard sensitivity
Human VKORC1L129-fold greater than VKORC1~29× less sensitive
Rat vkorc1Baseline referenceStandard sensitivity
Rat vkorc1l154-fold greater than vkorc1~54× less sensitive

These differences mean VKORC1L1 remains active at warfarin concentrations that inhibit VKORC1, potentially explaining why warfarin treatment affects tissues differently. The differential warfarin sensitivity contributes to tissue-specific VKOR activities, as the degree of warfarin sensitivity in various tissues is a function of the relative paralog expression ratio .

How does manipulation of Vkorc1l1 expression affect cellular redox homeostasis?

VKORC1L1 plays a significant role in cellular redox homeostasis. Experimental approaches using siRNA knockdown in human coronary artery smooth muscle cells (HCASMC) demonstrate:

  • Significantly increased superoxide radical release as measured by:

    • L-012 chemiluminescence assay (186.3 ± 22.62% vs. scrambled siRNA control, p = 0.009)

    • DCFDA assay (128.7 ± 10.82% vs. scrambled siRNA control, p = 0.04)

  • Increased H₂O₂ generation detected using Amplex™ Red Assay (105% ± 3.89 vs. 100 ± 3.68% for scrambled siRNA control, p = 0.046)

These findings confirm VKORC1L1's role in protecting cells against oxidative stress, consistent with previous observations in human embryonic kidney cells. The methodology requires precise measurement of reactive oxygen species using multiple complementary techniques to fully characterize the redox changes associated with VKORC1L1 deficiency .

What is the role of Vkorc1l1 in adipogenesis and metabolic regulation?

Research using Vkorc1l1 mutant mice from a forward genetic screen for obesity-related loci reveals:

  • Vkorc1l1 mutants display significantly lower fat-to-body weight ratio

  • Substantially decreased plasma leptin levels

  • Significantly underdeveloped white adipose tissue

In vitro studies confirm adipogenic defects related to Vkorc1l1 deficiency:

  • Downregulation of Vkorc1l1 increases intracellular vitamin K levels in preadipocytes

  • Increased vitamin K impedes preadipocyte differentiation

  • Vitamin K2 (but not vitamin K1) suppresses adipogenesis of stromal vascular fraction cells

These findings suggest Vkorc1l1 promotes adipogenesis and potentially contributes to obesity development. Methodologically, this research combined in vivo phenotyping of mutant mice with in vitro cellular studies to establish a mechanistic link between Vkorc1l1 function, vitamin K metabolism, and adipocyte differentiation .

How does Vkorc1l1 influence vascular smooth muscle cell function and neointima formation?

Investigation of VKORC1L1's role in vascular remodeling employed both in vivo and in vitro approaches:

In vivo model:

  • Murine vascular-injury model using C57/Bl6 mice randomized to receive:

    • Vehicle control

    • Vitamin K1 (1.5 mg/g food)-enriched diet

    • Vitamin K1 (1.5 mg/g) and warfarin (2 mg/g)-enriched diet

  • Vitamin K1 was co-administered with warfarin to prevent internal bleeding while assessing warfarin's extrahepatic effects

In vitro experiments:

  • VKORC1L1 knockdown in human coronary artery smooth muscle cells (HCASMC) led to:

    • Significantly higher cell viability (140.8 ± 12.1% vs. control, p = 0.0034)

    • Enhanced cell migration in wound-scratch assays after 12 hours (0.60 ± 0.05 vs. 0.49 ± 0.08 migration into wound scratch, p = 0.02)

These results suggest VKORC1L1 normally constrains vascular smooth muscle cell proliferation and migration—key processes in neointima formation. Methodologically, this research demonstrates the importance of combining in vivo injury models with cellular studies using targeted gene knockdown to elucidate VKORC1L1's role in vascular pathophysiology .

What are the optimal expression systems for producing recombinant Vkorc1l1 for enzymatic studies?

Based on the literature, several expression systems have been successfully employed for producing recombinant VKOR proteins:

Pichia pastoris expression system:

  • Successfully used for heterologous expression of both human and rat VKOR paralogs

  • Allows for determination of enzyme kinetics parameters (Michaelis-Menten constants)

  • Enables comparative enzymatic studies using c-myc tagged expression constructs

  • Provides sufficient yield for catalytic efficiency measurements, showing that:

    • Rat vkorc1 is 30-fold more catalytically efficient than rat vkorc1l1

    • Human VKORC1L1 is 2-fold more catalytically efficient than human VKORC1

The methodology requires careful optimization of expression conditions, protein extraction, and purification protocols to maintain enzyme activity. When conducting enzymatic assays with recombinant Vkorc1l1, researchers should:

  • Compare kinetic parameters with VKORC1 from the same species

  • Validate activity using multiple substrates

  • Test warfarin inhibition across a wide concentration range

What experimental approaches best characterize the interaction between Vitamin K analogs and Vkorc1l1?

Research into vitamin K-Vkorc1l1 interactions requires comprehensive approaches:

Cell culture models:

  • Cells should be seeded and allowed to adhere for 48 hours before treatment

  • Menaquinone-7 (MK7/Vitamin K2) dissolved in DMSO (0.5 mg/ml) and mixed with fresh cell medium

  • Treatment concentrations typically range from 1 to 10μM with 24-hour incubation periods

  • Co-incubation experiments with oxidized low-density lipoprotein (oxLDL), tunicamycin, or platelet-derived growth factor (PDGF) provide insights into interaction with cellular stress pathways

In vivo supplementation studies:

  • Dietary supplementation should be calibrated for specific vitamin K analogs (e.g., 1.5 mg/g food for vitamin K1)

  • For combined treatments with warfarin (such as 2 mg/g), co-administration of vitamin K1 prevents internal bleeding while allowing assessment of warfarin's extrahepatic effects

Measurement of intracellular vitamin K levels:

  • Vkorc1l1 mutant preadipocytes show increased intracellular vitamin K levels compared to wild-type cells

  • This increased vitamin K impedes preadipocyte differentiation, suggesting functional interactions

These methodological approaches help characterize how different vitamin K analogs interact with Vkorc1l1 and influence its cellular functions.

What are the recommended protocols for Vkorc1l1 gene knockdown experiments?

Based on the successful knockdown approaches described in the literature, researchers should consider:

siRNA transfection:

  • Successfully employed in human coronary artery smooth muscle cells (HCASMC)

  • Results in largely reduced expression levels of VKORC1L1 mRNA

  • Verification of knockdown efficiency through qPCR is essential

  • Control experiments using scrambled siRNA sequences are necessary to confirm specificity

Experimental validation:

  • Functional assays should be performed 24-48 hours post-transfection

  • Multiple siRNA constructs targeting different regions of the Vkorc1l1 transcript should be tested to rule out off-target effects

  • Rescue experiments with recombinant protein expression can confirm phenotype specificity

For precise temporal control over gene expression, inducible knockdown systems may be preferable to constitutive approaches, particularly when studying developmental processes like adipogenesis .

How can the enzymatic activity of Vkorc1l1 be accurately measured?

Accurate measurement of Vkorc1l1 enzymatic activity requires specialized techniques:

For recombinant protein studies:

  • Heterologous expression in Pichia pastoris with appropriate tags (e.g., c-myc) for detection and purification

  • Determination of Michaelis-Menten constants (Km) for vitamin K oxide substrate

  • Measurement of warfarin inhibition constants (Ki)

For tissue-specific VKOR activity:

  • Assess relative contributions of VKORC1 and VKORC1L1 to total VKOR activity in tissues

  • Compare wild-type tissues with those from gene-specific knockout models

  • Consider the additive nature of tissue-specific VKOR activities from both paralogs

Catalytic efficiency measurements:

  • Appropriate experimental conditions must be established to determine the true catalytic efficiency

  • For rat models, consider that vkorc1 has 30-fold greater VKOR catalytic efficiency than vkorc1l1

  • For human models, VKORC1L1 has 2-fold higher catalytic efficiency than VKORC1

These methodological approaches help characterize the enzymatic properties of Vkorc1l1 and distinguish its activity from that of VKORC1.

How is Vkorc1l1 expression regulated during development and in response to cellular stress?

Understanding Vkorc1l1 regulation requires examination across developmental stages and stress conditions:

Developmental regulation:

  • VKORC1L1 peptides have been detected in fetal brain and placenta, suggesting developmental roles

  • Expression regulation appears independent of VKORC1 levels, as vkorc1l1 expression in vkorc1-/- mice is not different from wild-type mice

Response to oxidative stress:

  • Expression is highest in tissues that generate intensely elevated levels of reactive oxygen species (ROS)

  • Adipocytes, CD34+ cell lines (including monocytic lines), and B lymphoblasts show significantly higher VKORC1L1 expression than median tissue levels

  • These cell types generate elevated ROS under physiological conditions, suggesting VKORC1L1's role in redox homeostasis

Methodological approaches:

  • ChIP-seq technology enables comprehensive tissue-specific expression profiling

  • Proteomics approaches using mass spectrometry can verify protein-level expression

  • Stress induction experiments (oxidative, ER stress, etc.) can reveal regulatory mechanisms

Research indicates that VKORC1 and VKORC1L1 expression involves independent regulatory pathways, suggesting distinct roles in cellular homeostasis .

What phenotypes emerge from tissue-specific Vkorc1l1 knockout models?

Tissue-specific phenotypes from Vkorc1l1 deficiency provide insights into its specialized functions:

Adipose tissue:

  • Vkorc1l1 mutant mice display significantly lower fat-to-body weight ratio

  • White adipose tissue is substantially underdeveloped

  • Plasma leptin levels are significantly decreased

Vascular tissue:

  • Vkorc1l1 deficiency leads to increased vascular smooth muscle cell viability and migration

  • These cellular changes are critical for neointima formation following vascular injury

Methodological considerations:

  • Tissue-specific conditional knockout models using Cre-loxP systems would provide more precise insights than global knockouts

  • Temporal control of gene deletion (inducible systems) can distinguish developmental from homeostatic functions

  • Complementary approaches using both in vivo models and primary cell cultures from specific tissues are optimal

These phenotypic analyses reveal the distinct roles of Vkorc1l1 in different tissues and development stages, highlighting its tissue-specific functions beyond vitamin K recycling.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.