Recombinant Rat Voltage-dependent calcium channel gamma-3 subunit (Cacng3)

Shipped with Ice Packs
In Stock

Description

Biological Role

Cacng3 stabilizes VGCCs in an inactive state, modulating calcium influx during neuronal depolarization . It also acts as a transmembrane AMPA receptor regulatory protein (TARP), influencing receptor trafficking and synaptic strength .

Key Functions:

  • Calcium Signaling: Regulates N-type VGCCs critical for synaptic transmission in hippocampal and cortical neurons .

  • Epilepsy Susceptibility: CACNG3 variants are linked to childhood absence epilepsy (CAE) and spike-wave seizures in animal models .

  • AMPA Receptor Regulation: Enhances surface expression and gating kinetics of AMPA receptors .

Research Applications

Recombinant Cacng3 is widely used in:

  • Antibody Validation: Serves as a control fragment in Western blot (WB) and immunohistochemistry (IHC) to block nonspecific antibody binding .

  • Functional Studies: Investigates calcium channel dynamics and AMPA receptor interactions in neurological disorders .

Table 2: Recommended Experimental Parameters

ApplicationMolar ExcessIncubation TimeTemperature
IHC/ICC/WB100×30 minutesRoom Temperature

Sequence and Ortholog Conservation

The rat Cacng3 shares 95% sequence identity with mouse and human orthologs, making it a cross-species functional homolog .

Cacng3 interacts with:

  • Calcium Signaling Pathways: Modulates L-type/N-type VGCCs .

  • Neurotransmitter Systems: Linked to glutamatergic signaling via AMPA receptors .

Research Findings

  • Epilepsy Models: Cacng3 knockout mice exhibit absence seizures, mirroring human CAE pathology .

  • AMD Risk: Human CACNG3 SNPs (e.g., rs2283550) correlate with age-related macular degeneration (AMD), suggesting calcium signaling roles in retinal degeneration .

Future Directions

Ongoing studies focus on:

  • Therapeutic Targeting: Small molecules to modulate Cacng3-AMPA interactions in epilepsy .

  • Structural Biology: Cryo-EM studies to resolve Cacng3-Calcium channel complexes .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. Please specify your desired tag type for preferential development.
Synonyms
Cacng3; Voltage-dependent calcium channel gamma-3 subunit; Neuronal voltage-gated calcium channel gamma-3 subunit; Transmembrane AMPAR regulatory protein gamma-3; TARP gamma-3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-315
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MRMCDRGIQMLITTVGAFAAFSLMTIAVGTDYWLYSRGVCRTKSTSDNETSRKNEEVMTH SGLWRTCCLEGAFRGVCKKIDHFPEDADYEQDTAEYLLRAVRASSVFPILSVTLLFFGGL CVAASEFHRSRHSVILSAGIFFVSAGLSNIIGIIVYISANAGDPGQRDSKKSYSYGWSFY FGAFSFIIAEIVGVVAVHIYIEKHQQLRARSHSELLKKSTFARLPPYRYRFRRRSSSRST EPRSRDLSPISKGFHTIPSTDISMFTLSRDPSKLTMGTLLNSDRDHAFLQFHNSTPKEFK ESLHNNPANRRTTPV
Uniprot No.

Target Background

Function
This protein regulates the trafficking and gating properties of AMPA-selective glutamate receptors (AMPARs) in the somatodendritic compartment. It promotes AMPAR targeting to the cell membrane and synapses, modulating gating by slowing activation, deactivation, and desensitization rates. It regulates all AMPAR subunits without subunit specificity. It is also believed to stabilize calcium channels in an inactivated (closed) state.
Database Links
Protein Families
PMP-22/EMP/MP20 family, CACNG subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the molecular characterization of rat Cacng3 and how can it be identified in experimental samples?

Rat Cacng3 (Q8VHX0/CCG3_RAT) is a voltage-dependent calcium channel gamma-3 subunit encoded by the Cacng3 gene. It is characterized as:

  • Protein length: 315 amino acids

  • Observed molecular weight: 40 kDa (calculated 36 kDa)

  • Structure: Type I transmembrane AMPA receptor regulatory protein (TARP)

For molecular identification and characterization, researchers should employ:

RT-PCR Approach:

  • Forward primer: 5′-gtatgaatacttcaatgctgtgctg-3′

  • Reverse primer: 5′-atttaatccctgggtactgtctga-3′

  • Expected fragment size: 305 bp (covering exons 4-7)

Western Blot Detection:

  • Recommended dilution: 1:500-1:2000

  • Positive controls: HEK-293 cells, mouse/rat brain tissue

  • Expected band: ~40 kDa

Immunohistochemistry Protocol:

  • Recommended dilution: 1:50-1:500

  • Antigen retrieval: TE buffer pH 9.0 (alternatively citrate buffer pH 6.0)

  • Expected primary locations: Brain tissue, particularly hippocampal regions

What is the expression profile and cellular localization of Cacng3 in rat models?

Cacng3 shows distinct expression patterns that researchers should consider when designing experiments:

Tissue Distribution:

  • Primary expression: Brain (highest in hippocampus)

  • Secondary expression: Retina

  • Low or undetectable: Peripheral tissues

Cellular Localization:

  • Primarily expressed in:

    • Ganglion cells (GCL)

    • Amacrine cells

    • Bipolar cells

    • Photoreceptors

    • Horizontal cells (minimal expression)

Subcellular Distribution:

  • Primarily in postsynaptic densities of dendritic structures

  • Specifically in hippocampal mossy fiber synapses

  • Also found in the inner plexiform layer (IPL) and outer plexiform layer (OPL)

Research strategies should consider these distribution patterns when planning tissue collection, immunostaining, or functional studies.

What are the standardized methods for cloning and recombinant expression of rat Cacng3?

For successful recombinant expression of rat Cacng3, researchers should follow these methodological guidelines:

Cloning Strategy:

  • Isolate total RNA from rat brain tissue using commercially available kits

  • Generate cDNA using oligo(dT) primers and SuperScript III or equivalent reverse transcriptase

  • Amplify the complete coding sequence (full ORF: 948 bp) using high-fidelity polymerase

  • Clone into expression vectors such as pcDNA3.1 with appropriate tags (e.g., Strep-tag, His-tag)

Expression Systems (by effectiveness):

  • HEK-293 cells: Highest expression yield with proper post-translational modifications

  • Cell-free protein synthesis (CFPS): Moderate yield but faster production

  • Bacterial systems: Lower yield but cost-effective

Purification Protocol:

  • For Strep-tagged constructs: Use one-step Strep-tag purification

  • For His-tagged constructs: Use IMAC purification with nickel resins

  • Expected purity: >70-80% for initial purification, >90% after secondary purification steps

How do post-translational modifications affect rat Cacng3 function and what methods are available to study them?

Rat Cacng3 undergoes several post-translational modifications that critically affect its function and localization:

Key Modification Sites:

SiteModification TypeDetection MethodFunctional Impact
S211PhosphorylationPhospho-specific antibodiesAlters channel gating properties
K217UbiquitinationUbiquitin-specific antibodiesAffects protein turnover
S244PhosphorylationMS/MS analysisModerates AMPA receptor interaction
S248PhosphorylationValidated by PMID: 22673903Critical for membrane trafficking

Methodological Approaches to Study PTMs:

  • Site-directed mutagenesis: Convert modification sites to non-modifiable residues (e.g., S→A, K→R)

  • Phosphomimetic mutations: S→D or S→E to mimic constitutive phosphorylation

  • Mass spectrometry: For comprehensive identification of all modification sites

  • Pharmacological treatment: Use kinase/phosphatase inhibitors to manipulate modification state

Functional Assays:

  • Electrophysiology to assess channel properties

  • FRET-based assays to study protein-protein interactions

  • Live-cell imaging to track trafficking dynamics

What are the experimental challenges in studying Cacng3-mediated calcium signaling in neuronal preparations?

Researchers face several challenges when investigating Cacng3 function in calcium signaling:

Technical Challenges and Solutions:

  • Low endogenous expression levels:

    • Use targeted enrichment techniques

    • Consider lentiviral overexpression systems

    • Develop highly sensitive detection methods using signal amplification

  • Functional redundancy with other gamma subunits:

    • Implement combinatorial knockout approaches

    • Use subunit-specific pharmacological tools

    • Design dominant-negative constructs

  • Electrophysiological recording complexity:

    • For voltage-dependent calcium channel recordings, use Ba²⁺ as charge carrier to prevent Ca²⁺-dependent inactivation

    • Apply depolarizing prepulses to assess voltage-dependent inhibition

    • Implement paired-pulse protocols to investigate facilitation

Recommended Approaches:

  • Combine electrophysiology with optical imaging using genetically encoded calcium indicators

  • Use heterologous expression systems with controlled subunit composition before moving to more complex neuronal models

  • Implement acute genetic manipulation (e.g., CRISPR) rather than constitutive knockouts to avoid developmental compensation

How can CRISPR-Cas9 technology be optimized for studying Cacng3 function in rat models?

CRISPR-Cas9 provides powerful tools for Cacng3 research, but requires careful optimization:

Validated gRNA Design:

  • Use established gRNA sequences designed by the Zhang laboratory at the Broad Institute

  • For higher success rates, target multiple sites simultaneously

  • Confirm specificity through whole-genome sequence alignment

Delivery Methods (ranked by efficiency):

  • Lentiviral delivery (for cell lines and primary cultures)

  • In utero electroporation (for developmental studies)

  • AAV-mediated delivery (for adult rat brain regions)

Validation Strategies:

  • mRNA level: RT-qPCR using validated primers

  • Protein level: Western blot with anti-Cacng3 antibodies

  • Functional validation: Electrophysiological assessment of calcium channel properties

  • Off-target analysis: Targeted sequencing of predicted off-target sites

Recommendations for Knockout Verification:

  • Design multiple independent verification methods

  • Assess both structural and functional consequences

  • Consider using reporter systems (e.g., LacZ insertion) for spatial expression analysis

What is the role of Cacng3 in neurological disorders and how can rat models inform therapeutic developments?

Cacng3 has been implicated in several neurological conditions with promising therapeutic potential:

Disease Associations:

ConditionRole of Cacng3Rat Model FindingsTherapeutic Implications
Epilepsy (particularly absence seizures)Susceptibility locusAltered expression in hippocampus during seizure modelsPotential target for anti-epileptic drug development
GliomasPrognostic biomarker (lower expression correlates with poor prognosis)Expression decreases in higher-grade gliomasPotential diagnostic marker and treatment target
Ischemic strokeAltered expression in transient ischemic attack modelsDownregulation in RIND but not TIA conditionsPotential biomarker for differentiating stroke subtypes

Research Approaches:

  • For expression analysis:

    • RT-qPCR for transcript levels

    • Western blot for protein quantification

    • IHC for spatial distribution changes

  • For functional assessment:

    • Electrophysiology to measure calcium channel properties

    • Calcium imaging to assess signaling dynamics

    • Behavioral assessments in transgenic models

  • For therapeutic development:

    • Screen for compounds that modulate Cacng3 expression

    • Test whether temozolomide increases Cacng3 expression in a dose and time-dependent manner, as observed in glioma models

    • Evaluate gene therapy approaches to restore normal Cacng3 expression

How does Cacng3 interact with other calcium channel subunits and AMPA receptors in complex neuronal circuits?

Understanding Cacng3's interactions requires sophisticated research approaches:

Key Interaction Partners:

  • α1 pore-forming subunits of calcium channels

  • α2δ auxiliary subunits

  • β auxiliary subunits

  • AMPA receptor subunits

Advanced Methods for Studying Protein Interactions:

  • Proximity labeling techniques:

    • BioID or TurboID fusion proteins to identify proximal proteins in living neurons

    • APEX2-based approaches for temporal control of labeling

  • High-resolution imaging:

    • Super-resolution microscopy (STORM, PALM)

    • Expansion microscopy for improved spatial resolution

    • FRET-based approaches for direct interaction assessment

  • Functional interaction studies:

    • Paired recordings from synaptically connected neurons

    • Optogenetic manipulation of specific circuit elements

    • Coincidence detection assays to assess timing-dependent interactions

Physiological Significance:

  • Cacng3 primarily functions to modulate both:

    • Calcium channel activity (downregulating calcium influx)

    • AMPA receptor trafficking and gating

  • These dual roles position Cacng3 as a critical regulator of synaptic function and plasticity

What are the evolutionary implications of Cacng3 conservation across species and how should this inform experimental design?

Understanding evolutionary aspects of Cacng3 provides critical insights for cross-species research:

Phylogenetic Analysis:

  • Cacng3 emerged from ancient tandem duplications that preceded chromosome duplication events

  • Part of an eight-member protein subfamily of the PMP-22/EMP/MP20 family

  • The γ subunit gene family evolved through complex genomic rearrangements

Cross-Species Considerations:

SpeciesKey DifferencesExperimental Implications
Human (O60359)Higher sequence conservation in functional domainsFindings in rat models likely translatable to human disease
MouseNearly identical to rat in structure and functionUseful alternative model for genetic studies
Equus asinusEvolutionarily distinct but conserved functional domainsProvides insights into essential vs. variable regions

Research Design Recommendations:

  • Target highly conserved domains for interventions with cross-species relevance

  • Use species-specific antibodies and primers for detection

  • Account for potential species differences in post-translational modification sites

  • Consider species-specific regulatory mechanisms when studying expression patterns

What methodological considerations are essential for investigating Cacng3 in specialized cellular compartments like dendritic spines and synaptic membranes?

Investigating Cacng3 in specialized neuronal compartments requires sophisticated approaches:

Challenges in Subcellular Research:

  • Small size of dendritic spines (typically <1μm³)

  • Dynamic nature of synaptic proteins

  • Protein complex heterogeneity at synapses

  • Limited material for biochemical analysis

Advanced Methodological Solutions:

  • Subcellular fractionation protocols:

    • Prepare synaptosomes followed by PSD (postsynaptic density) extraction

    • Use detergent-based methods to isolate membrane vs. cytosolic fractions

    • Employ size-based separation techniques for spine vs. shaft components

  • High-resolution imaging approaches:

    • Two-photon imaging for deep tissue visualization

    • FRAP (Fluorescence Recovery After Photobleaching) to assess mobility

    • Single-molecule tracking to monitor dynamic behavior

    • Correlative light-electron microscopy for ultrastructural context

  • Functional compartment-specific assays:

    • Local calcium imaging using spine-targeted indicators

    • Local protein synthesis assessment using photoconvertible reporters

    • Optogenetic manipulation of specific synaptic populations

Analysis Recommendations:

  • Combine multiple complementary techniques to overcome limitations of individual methods

  • Use computational approaches to analyze complex spatiotemporal datasets

  • Implement careful controls to distinguish genuine localization from artifacts

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.