Recombinant Rat Voltage-dependent calcium channel gamma-6 subunit (Cacng6)

Shipped with Ice Packs
In Stock

Description

Functional Roles and Biological Significance

Cacng6 is a regulatory subunit of voltage-gated L-type calcium channels (VLCCs), which mediate Ca²⁺ influx in excitable cells. Its primary roles include:

  • Channel Stabilization: Maintains calcium channels in an inactive state, modulating Ca²⁺ signaling .

  • AMPAR Regulation: Facilitates trafficking and gating of AMPA-selective glutamate receptors (AMPARs) to synaptic membranes, influencing neuronal plasticity .

  • Disease Associations: Linked to schizophrenia (SCZ) and aspirin-intolerant asthma (AIA) through genetic polymorphisms .

Research Applications

Recombinant Cacng6 is pivotal in:

  1. Calcium Channel Studies: Investigating VLCC modulation in cardiac, muscular, and neuronal tissues.

  2. Neurological Disorders: Assessing SCZ risk via SNPs (e.g., rs192808 in CACNG6) .

  3. Drug Development: Screening compounds targeting calcium channelopathies or AMPAR dysregulation.

  4. Toxicology: Evaluating chemical-induced gene expression changes (e.g., bisphenol A, cisplatin) .

Table 1: Genetic Associations of Cacng6 in Human Diseases

DiseaseKey PolymorphismEffect Size (OR)Study PopulationCitation
Schizophreniars192808 (intronic)OR = 0.856Han Chinese (n=12,462)
Aspirin-Intolerant Asthmars192808 (intronic)OR = 2.88–2.99Korean (n=531)

Table 2: Epistatic Interactions Involving Cacng6

Gene PairSNP InteractionP-ValueBiological Implication
CACNG6CACNG5rs192808 × rs2048137P=2.93×106P = 2.93 \times 10^{-6}Synergistic risk for schizophrenia

Technical Considerations for Experimental Use

  • Storage Stability: Avoid repeated freeze-thaw cycles; aliquot for long-term storage .

  • Activity Validation: Functional assays (e.g., electrophysiology, AMPAR trafficking assays) are recommended due to its regulatory role .

  • Related Products:

    • Recombinant Human CACNG6 (GST-tagged) .

    • Mouse Cacng6 (Myc/DDK-tagged) .

Emerging Insights and Future Directions

  • Cancer Research: Somatic mutations in CACNG6 are cataloged in COSMIC, though functional impacts remain unclear .

  • Environmental Toxicology: Upregulation by silver nanoparticles and downregulation by sodium arsenite suggest roles in cellular stress responses .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Please note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us. We will prioritize developing the specified tag if possible.
Synonyms
Cacng6; Voltage-dependent calcium channel gamma-6 subunit; Neuronal voltage-gated calcium channel gamma-6 subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-260
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MMWSNFFMQEEDRRRTAVGRRRAQEQQNLGLTPEREGKIKLGLLVAIVGATLAVLAVGTE FWVELNTYKTNGSAVCEAAHLGLWKVCIKRLWQADVPAGRETCGPAELPGEANCTYFKFF TTGENAHIFQRTTKKEVNLAAAVIAVLGLTAMALGCLCVIMVLSKGAEFLLRLGAVCFGL SGLLLFVSLEVFRHSVRALLQGVNPETPPAPRLAYEYSWSLGCGVGAGLILLLGGVCFLL LTLPSWPWRSLCPKRGGPTA
Uniprot No.

Target Background

Function
The Recombinant Rat Voltage-dependent calcium channel gamma-6 subunit (Cacng6) plays a crucial role in regulating the activity of L-type calcium channels that contain CACNA1C as the pore-forming subunit.
Database Links
Protein Families
PMP-22/EMP/MP20 family, CACNG subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Detected in heart atrium and ventricle, aorta and skeletal muscle. Detected in heart left ventricle.

Q&A

What is the basic structure and function of CACNG6?

CACNG6 (calcium voltage-gated channel auxiliary subunit gamma 6) is a member of the voltage-dependent calcium channel gamma subunit family. Structurally, it functions as an auxiliary protein that modulates the properties of voltage-gated calcium channels. The protein contains several transmembrane domains and plays a crucial role in regulating calcium influx across cellular membranes .

For experimental investigation of structure-function relationships, researchers typically employ:

  • Site-directed mutagenesis to identify critical functional residues

  • Electrophysiological techniques (patch-clamp recordings) to measure channel properties

  • Fluorescence resonance energy transfer (FRET) to examine protein-protein interactions within the channel complex

How does rat CACNG6 differ from human CACNG6 in experimental models?

When comparing rat and human CACNG6 in experimental contexts, researchers should consider:

  • Sequence homology analysis shows conservation of key functional domains but species-specific variations in regulatory regions

  • Electrophysiological properties may differ subtly between species, particularly in activation and inactivation kinetics

  • Expression patterns across tissues show some divergence between rat and human models

For cross-species experiments, implement:

  • Western blotting with species-specific antibodies

  • Species-appropriate positive controls in functional assays

  • Careful interpretation of pharmacological responses that may vary between species

What are recommended methods for recombinant CACNG6 expression and purification?

For optimal recombinant rat CACNG6 expression:

  • Expression System Selection:

    • Mammalian systems (HEK293, CHO cells) preserve post-translational modifications

    • Insect cell systems (Sf9, High Five) offer higher yield but different glycosylation patterns

    • Bacterial systems are challenging due to membrane protein properties but can be optimized with fusion tags

  • Purification Strategy:

    StepMethodCritical Parameters
    ExtractionDetergent solubilizationDetergent type and concentration
    CaptureAffinity chromatographyTag position (N vs C-terminal)
    PolishingSize exclusion chromatographyBuffer composition, pH
    Quality ControlSDS-PAGE, Western blot, Mass spectrometryPurity assessment criteria
  • Functional Validation:

    • Reconstitution into liposomes for ion flux assays

    • Co-immunoprecipitation with known binding partners

    • Circular dichroism to verify proper folding

What is the tissue-specific expression pattern of CACNG6 in rat models?

CACNG6 demonstrates distinctive expression patterns across rat tissues:

  • Highest expression observed in lung tissues

  • Moderate expression in brain regions, particularly in excitable neural tissues

  • Lower expression in cardiac and skeletal muscle compared to other calcium channel subunits

For expression analysis, researchers should:

  • Use quantitative RT-PCR with tissue-specific reference genes

  • Implement RNAscope or in situ hybridization for spatial resolution within tissues

  • Validate with immunohistochemistry using specific antibodies verified against knockout controls

  • Consider developmental stage variations when designing experiments

What are effective methods for detecting endogenous vs. recombinant CACNG6 in experimental systems?

To differentiate between endogenous and recombinant CACNG6:

  • Antibody-based approaches:

    • Use epitope tags (HA, FLAG, Myc) on recombinant proteins

    • Employ antibodies targeting species-specific regions for distinction

    • Implement dual-labeling immunofluorescence with tag-specific antibodies

  • Genetic approaches:

    • Design primers spanning vector-insert junctions for PCR detection of recombinant transcripts

    • Consider fluorescent protein fusions for live imaging (verify functionality)

    • Use CRISPR/Cas9 knockin strategies for endogenous tagging

  • Functional approaches:

    • Utilize electrophysiological signatures of overexpression

    • Implement inducible expression systems to control recombinant levels

What are the known functional interaction partners of CACNG6?

CACNG6 interacts with several proteins within calcium channel complexes and beyond:

  • Primary interactions:

    • α1 subunits of voltage-gated calcium channels

    • β subunits that modulate channel trafficking

    • α2δ auxiliary subunits that affect channel biophysical properties

  • Secondary interactions:

    • Potential interaction with other gamma subunits (CACNG5) as suggested by epistasis analysis

    • Cytoskeletal elements involved in membrane targeting

To identify novel interaction partners:

  • Apply proximity labeling techniques (BioID, APEX)

  • Implement co-immunoprecipitation followed by mass spectrometry

  • Use yeast two-hybrid screening with membrane-specific adaptations

The interaction between CACNG6 and other calcium channel subunits exhibits tissue-specific variations that should be considered when designing experiments.

How can researchers effectively study CACNG6 phosphorylation and its functional consequences?

CACNG6 contains multiple phosphorylation sites, including documented sites at S188 and S195 , which may regulate channel function:

  • Detection methods:

    • Phospho-specific antibodies for key residues

    • Phos-tag SDS-PAGE for mobility shift detection

    • Mass spectrometry with phosphopeptide enrichment

  • Functional assessment:

    • Site-directed mutagenesis (phosphomimetic mutations: S→D; phospho-null mutations: S→A)

    • Patch-clamp electrophysiology before and after kinase activator/inhibitor treatment

    • Live cell imaging with phosphorylation biosensors

  • Kinase identification:

    Predicted KinaseTarget ResidueConsensus SequenceValidation Method
    PKAS188RXXSIn vitro kinase assay
    CaMKIIS195RXXS/TPharmacological inhibition
    PKCMultiple sitesS/TXK/RGenetic approaches

What is the evidence for CACNG6 involvement in neuropsychiatric disorders?

Research suggests CACNG6 may contribute to neuropsychiatric conditions:

  • Schizophrenia associations:

    • Significant statistical interaction between CACNG6 (rs192808) and CACNG5 (rs2048137) identified in genetic studies

    • Both double homozygote GG-TT and double heterozygote GA-GT (rs192808-rs2048137) genotypes were overrepresented in control samples, suggesting a protective effect

  • Mechanistic considerations:

    • Calcium signaling dysregulation is implicated in prefrontal-hippocampal network plasticity, which is relevant to schizophrenia pathophysiology

    • CACNG6 may modulate glutamatergic neurotransmission through interaction with calcium channels at synapses

For investigating neuropsychiatric connections:

  • Implement conditional knockout models targeting specific brain regions

  • Assess behavioral phenotypes using validated schizophrenia endophenotype paradigms

  • Utilize human-derived neural models (iPSC-derived neurons) carrying relevant polymorphisms

What is the potential role of CACNG6 in cardiac pathophysiology?

Note: A previous publication suggesting CACNG6 involvement in cardiac hypertrophy through miR-296-5p regulation has been retracted due to concerns regarding data reliability . Therefore, researchers should approach this area with caution.

When investigating potential cardiac roles:

  • Experimental approaches:

    • Cardiomyocyte-specific conditional expression/deletion models

    • Pressure-overload models with careful temporal analysis of CACNG6 expression

    • Calcium imaging in isolated cardiomyocytes from relevant models

  • Essential controls:

    • Multiple independent methods for measuring hypertrophic responses

    • Rigorous statistical analysis with appropriate sample sizes

    • Independent validation in different model systems

What are state-of-the-art approaches for studying CACNG6 channel dynamics in living cells?

Modern approaches to investigating CACNG6 dynamics include:

  • Advanced imaging techniques:

    • Super-resolution microscopy (STORM, PALM) for nanoscale localization

    • Single-particle tracking for mobility analysis within membranes

    • FRET-based sensors for conformational changes

  • Electrophysiological approaches:

    • Simultaneous patch-clamp and fluorescence imaging

    • Optogenetic coupling to manipulate channel activity

    • Automated high-throughput electrophysiology for pharmacological screening

  • Computational modeling:

    • Molecular dynamics simulations to predict structural changes

    • Systems biology approaches integrating channel kinetics into cellular models

    • Machine learning algorithms for pattern recognition in complex datasets

How should researchers design experiments to study CACNG6 interactions with other calcium channel subunits?

To effectively investigate CACNG6 subunit interactions:

  • Co-expression systems:

    • Heterologous expression with titrated subunit ratios

    • Bicistronic constructs to ensure co-expression

    • FRET/BRET approaches for direct interaction measurement

  • Experimental design considerations:

    ApproachAdvantagesLimitationsControls
    Co-immunoprecipitationDetects native complexesDisruption during lysisIgG controls, reverse IP
    FRETLive cell analysisDistance constraintsDonor/acceptor-only controls
    BiFCHigh sensitivityIrreversibleFragment-only controls
    Proximity LigationSingle molecule detectionAntibody specificityPrimary antibody omission
  • Functional validation:

    • Electrophysiological characterization of co-expressed channels

    • Trafficking assays examining surface expression

    • Pharmacological sensitivity profiles of assembled complexes

What approaches are recommended for studying transcriptional and epigenetic regulation of CACNG6?

For investigating CACNG6 regulation mechanisms:

  • Promoter analysis:

    • Luciferase reporter assays with progressive deletions

    • ChIP-seq for transcription factor binding

    • CRISPR interference/activation for functional validation

  • Epigenetic regulation:

    • Bisulfite sequencing for DNA methylation analysis

    • ChIP for histone modifications

    • ATAC-seq for chromatin accessibility

  • Post-transcriptional regulation:

    • RNA stability assays with actinomycin D chase

    • 3'UTR reporter assays for miRNA targeting

    • RNA immunoprecipitation for RNA-binding protein interactions

How can CRISPR/Cas9 technologies be optimized for CACNG6 functional studies?

CRISPR/Cas9 approaches for CACNG6 research:

  • Knockout strategies:

    • Design multiple sgRNAs targeting early exons

    • Implement careful validation including sequencing and western blotting

    • Consider potential compensatory upregulation of other gamma subunits

  • Knockin approaches:

    • HDR-mediated introduction of tags or mutations

    • Base editing for specific nucleotide changes

    • Prime editing for precise modifications without double-strand breaks

  • Experimental considerations:

    ApplicationDelivery MethodValidation ApproachPotential Pitfalls
    Complete KOLentiviralSequencing, Western blotOff-target effects
    Domain mutationElectroporationFunctional assaysMosaic expression
    Reporter knockinLipofectionLive imagingSilent mutations affecting splicing

How can researchers address conflicting findings regarding CACNG6 function across different experimental systems?

When confronting contradictory results:

  • Systematic analysis of methodological differences:

    • Cell type-specific effects (heterologous vs. native systems)

    • Experimental conditions (recording solutions, temperature)

    • Protein expression levels and stoichiometry

  • Reconciliation strategies:

    • Direct side-by-side comparisons under identical conditions

    • Collaborative cross-laboratory validation

    • Preregistration of experimental protocols

  • Reporting recommendations:

    • Full methodological transparency

    • Publication of negative results

    • Data sharing in standardized formats

What are the current limitations in CACNG6 research tools and how can they be addressed?

Current challenges include:

  • Antibody specificity:

    • Limited availability of highly specific antibodies for rat CACNG6

    • Cross-reactivity with other gamma subunits

    • Solution: Validate with knockout controls and peptide competition assays

  • Functional assays:

    • Difficulty isolating CACNG6-specific effects from other channel components

    • Variability in recombinant expression systems

    • Solution: Develop subunit-specific pharmacological tools

  • Physiological relevance:

    • Gap between heterologous systems and in vivo function

    • Incomplete understanding of native subunit composition

    • Solution: Develop tissue-specific conditional models with careful phenotyping

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.