Recombinant Rat Vomeronasal type-1 receptor 41 (Vmn1r41)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for your use.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Vom1r97; V1ra12; V1rb9; Vmn1r41; Vomeronasal type-1 receptor 97; Pheromone receptor VN5; Vomeronasal receptor 5; Vomeronasal type-1 receptor 41; Vomeronasal type-1 receptor B12; Vomeronasal type-1 receptor B9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Vom1r97
Target Protein Sequence
MNKDNILHTDTNIKITLFSEVSIGISANSALFFSHLFMLFEKNRSKPIDLYIAFLSLTQL MLLITIGLIAADMFMSRGRWDSTTCQSLIYLHRLLRGFTLCATCLLNVLWTITLSPRSSC LTTFKHKSPHHISGAFLFFCVLYISFGSHLFLSTIATPNLTSDNFMYVTQSCSFLPMSYS RTSMFSTPMAIREALLIGLIGLSSGYMVAFLWRHKNQARHLHSTSLSSKVSPEQRATRTI MILMSFFVVLYILENVVFYSRMTFKDGSMFYCVQIIVSHSYATISPFVFICTEKRIIKLW GSMSSRIVSI
Uniprot No.

Target Background

Function
Putative pheromone receptor involved in the regulation of social and reproductive behaviors.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in 1-4% of neurons of the vomeronasal organ. Only one pheromone receptor gene may be expressed in a particular neuron. Not expressed in the main olfactory epithelium.

Q&A

What is Vmn1r41 and what is its role in the rat olfactory system?

Vmn1r41, also known as Pheromone receptor VN5, Vomeronasal receptor 5, Vomeronasal type-1 receptor B12, or Vomeronasal type-1 receptor B9, is a G protein-coupled receptor expressed in the vomeronasal organ (VNO) of rats. This receptor plays a crucial role in pheromone detection and social communication behaviors. The full-length protein consists of 310 amino acids and is encoded by the Vmn1r41 gene, which has synonyms including V1ra12 and V1rb9 . Functionally, Vmn1r41 belongs to the V1R family of vomeronasal receptors that typically couple with Gαi2 proteins to transduce chemical signals from pheromones into neuronal responses that ultimately influence social and reproductive behaviors.

How does recombinant Vmn1r41 differ from the native receptor?

Recombinant Vmn1r41 is produced through heterologous expression systems, typically in E. coli or mammalian cell lines, rather than being extracted directly from rat vomeronasal tissue. While the amino acid sequence is identical to the native form, several differences should be considered in research applications:

CharacteristicNative Vmn1r41Recombinant Vmn1r41
Post-translational modificationsNatural glycosylation patternsMay lack or have altered glycosylation depending on expression system
Membrane environmentEmbedded in native lipid bilayerOften solubilized with detergents or reconstituted in artificial membranes
Protein associationsAssociated with native signaling complexesIsolated protein or fused with tags (His, GST, etc.)
ConformationNative folding stabilized by cellular environmentMay have subtle differences in tertiary structure
PurityPresent among other cellular proteinsHigher purity (typically >90%)

These differences can impact functional assays and structural studies, requiring careful experimental design and appropriate controls when working with recombinant versions of the receptor.

What are the most effective expression systems for producing functional recombinant Vmn1r41?

When designing expression systems for Vmn1r41, researchers must consider several factors that impact protein functionality and yield. Based on current methodologies for GPCRs and vomeronasal receptors, the following approaches have shown varying degrees of success:

Expression SystemAdvantagesLimitationsOptimization Strategies
E. coliHigh yield, cost-effective, rapid expressionLacks mammalian post-translational modifications, inclusion body formation commonUse specialized strains (e.g., Rosetta, C41/C43), fusion with solubility tags (MBP, SUMO), lower induction temperature (16-18°C)
Mammalian cells (HEK293, CHO)Proper folding, post-translational modificationsLower yield, higher cost, slower productionCodon optimization, stable cell line development, inducible expression systems
Insect cells (Sf9, Hi5)Higher yield than mammalian cells, some post-translational modificationsComplex setup, specialized expertise requiredOptimize MOI, harvest timing, supplement with chaperones
Cell-free systemsRapid, avoids toxicity issuesLower yield, high costSupplement with lipids, optimize redox conditions

The choice depends on research objectives—structural studies may prioritize yield while functional assays require proper folding and modifications. A systematic experimental design comparing different expression conditions is recommended for optimizing recombinant Vmn1r41 production for specific applications .

How should researchers design experiments to identify ligands for Vmn1r41?

Designing experiments to identify Vmn1r41 ligands requires a systematic approach combining computational prediction and experimental validation. An effective experimental design includes:

  • Computational Screening Phase:

    • Homology modeling of Vmn1r41 based on structurally characterized GPCRs

    • Virtual screening of potential pheromone compounds against the predicted binding pocket

    • Molecular dynamics simulations to evaluate binding stability

  • Primary Screening Assays:

    • Calcium imaging in heterologous expression systems (HEK293 cells expressing Vmn1r41)

    • BRET/FRET assays to detect conformational changes upon ligand binding

    • Membrane potential assays using voltage-sensitive dyes

  • Secondary Validation:

    • Dose-response studies with candidate ligands (concentration ranges: 10^-10 to 10^-5 M)

    • Competition binding assays with radiolabeled known ligands

    • Receptor mutagenesis to confirm binding pocket residues

  • In vivo Confirmation:

    • Electrophysiological recordings from Vmn1r41-expressing VNO neurons

    • Behavioral assays to assess physiological relevance of identified ligands

Statistical considerations should include randomization of compound testing, appropriate replicates (minimum n=5 for each condition), and robust statistical analysis (e.g., two-way ANOVA with Bonferroni post-hoc tests) to account for variability in receptor expression and response magnitude .

What controls are necessary when performing functional assays with recombinant Vmn1r41?

Robust experimental design for Vmn1r41 functional assays requires comprehensive controls to ensure data validity and reproducibility:

Control TypePurposeImplementation
Negative expression controlVerify signal specificityCells transfected with empty vector
Positive functional controlValidate assay systemKnown functional GPCR with established ligand response
Vehicle controlAccount for solvent effectsMatching concentration of ligand solvent (DMSO, ethanol)
Receptor density controlNormalize for expression levelsFlow cytometry or Western blot quantification
Signal transduction controlConfirm signaling pathway functionalityDirect activation of downstream components (e.g., forskolin for cAMP)
Non-cognate receptor controlTest ligand specificityClosely related vomeronasal receptor (e.g., Vmn1r42)
Receptor mutagenesisValidate binding siteAlanine scanning of predicted binding pocket residues

Additionally, experiments should incorporate concentration-response relationships with appropriate curve fitting (four-parameter logistic model) and time-course measurements to capture receptor kinetics. Quantitative readouts should be normalized to receptor expression levels to account for transfection variability across experiments .

How can structural studies of Vmn1r41 be optimized to overcome GPCR crystallization challenges?

Structural determination of Vmn1r41 presents significant challenges due to its hydrophobicity and conformational flexibility. Researchers should consider implementing an integrated approach:

  • Protein Engineering Strategies:

    • Thermostabilizing mutations identified through alanine scanning

    • Fusion with crystallization chaperones (e.g., T4 lysozyme, BRIL)

    • Truncation of flexible N/C-terminal regions while preserving functional domains

    • Introduction of disulfide bonds to stabilize specific conformations

  • Advanced Crystallization Approaches:

    • Lipidic cubic phase (LCP) crystallization optimized for Vmn1r41

    • Crystallization in complex with stabilizing nanobodies or antibody fragments

    • Bicelle crystallization methods with varied lipid compositions

  • Alternative Structural Methods:

    • Cryo-electron microscopy (resolution now reaching <3Å for membrane proteins)

    • Hydrogen-deuterium exchange mass spectrometry to map conformational dynamics

    • Solid-state NMR approaches for specific domains or peptide fragments

  • Computational Integration:

    • Molecular dynamics simulations to guide stabilization strategies

    • Machine learning approaches to predict optimal crystallization conditions

    • Integrative modeling combining low-resolution experimental data

Researchers should systematically evaluate protein stability using thermal shift assays (TSA) and size exclusion chromatography with multi-angle light scattering (SEC-MALS) before attempting crystallization trials. Successful structural studies typically require screening hundreds of conditions with iterative optimization .

What are the methodological considerations for investigating Vmn1r41 signaling pathways in heterologous systems?

Investigating Vmn1r41 signaling pathways requires careful consideration of the receptor's native environment and signaling partners. A comprehensive methodology includes:

  • Signaling Component Reconstitution:

    • Co-expression of Vmn1r41 with appropriate G-protein subunits (Gαi2, Gβγ)

    • Introduction of VNO-specific scaffold proteins and signaling modulators

    • TRPC2 channel co-expression for calcium signaling measurements

  • Pathway Dissection Approaches:

    • Pharmacological inhibitors targeting specific pathway components

    • RNA interference to selectively knockdown signaling intermediates

    • CRISPR-Cas9 gene editing to create signaling component knockouts

  • Multi-parameter Signaling Analysis:

    • Simultaneous measurement of multiple second messengers (Ca²⁺, cAMP, IP₃)

    • Temporal resolution of signaling events using real-time biosensors

    • Single-cell analysis to account for heterogeneity in receptor expression

  • Computational Modeling:

    • Ordinary differential equation (ODE) models of signaling cascade

    • Sensitivity analysis to identify rate-limiting steps

    • Comparison of signaling kinetics between heterologous systems and native VNO neurons

A systematic experimental approach comparing different expression systems (HEK293, CHO, Sf9) can help identify cell type-specific factors influencing Vmn1r41 signaling. Researchers should also consider creating stable cell lines with inducible Vmn1r41 expression to ensure consistent receptor levels across experiments .

How can researchers effectively analyze contradictory data in Vmn1r41 ligand identification studies?

Contradictory results in Vmn1r41 ligand identification studies are common due to methodological differences and complex receptor-ligand interactions. A systematic approach to reconciling discrepancies includes:

  • Methodological Assessment:

    • Compare experimental conditions across studies (pH, temperature, ionic composition)

    • Evaluate receptor expression systems and verification methods

    • Assess detection sensitivities of different functional assays

    • Examine ligand preparation, purity, and concentration verification methods

  • Statistical Reanalysis:

    • Implement Bayesian analysis to integrate results across multiple studies

    • Conduct meta-analysis using standardized effect sizes

    • Assess publication bias through funnel plot analysis

    • Calculate confidence intervals for EC₅₀/IC₅₀ values across studies

  • Validation Experiments:

    • Design head-to-head comparisons using standardized protocols

    • Implement orthogonal assay technologies for key findings

    • Use genetic approaches (receptor mutagenesis) to confirm binding mechanisms

    • Conduct cross-laboratory validation studies with identical reagents

  • Biological Context Consideration:

    • Evaluate potential allosteric modulators present in different experimental systems

    • Consider receptor heterogeneity (splice variants, post-translational modifications)

    • Assess receptor oligomerization status across different studies

    • Examine species or strain differences in receptor function

By systematically examining methodological variables and implementing robust statistical approaches, researchers can differentiate between true biological phenomena and technical artifacts. This comprehensive approach helps resolve apparent contradictions and advances understanding of Vmn1r41-ligand interactions .

What high-throughput screening (HTS) approaches are most effective for Vmn1r41 ligand discovery?

High-throughput screening for Vmn1r41 ligand discovery requires specialized approaches that account for the receptor's unique properties. Effective methodologies include:

Screening ApproachThroughput CapacityDetection MethodAdvantagesLimitations
FLIPR calcium assays384-1536 wells/plateFluorescent calcium indicatorsRapid kinetic readout, established protocolsPotential false positives from non-specific calcium release
Bioluminescence resonance energy transfer (BRET)384 wells/plateLuciferase-tagged receptor and fluorescent G-proteinsDirect measurement of receptor-G protein interactionLower throughput, requires specialized equipment
Label-free technologies (DMR, SPR)384 wells/plateOptical detection of cellular mass redistributionNo artificial tags required, detects multiple pathwaysHigher cost, complex data interpretation
Fluorescent membrane potential assays1536 wells/plateVoltage-sensitive dyesHigh sensitivity, suitable for miniaturizationPotential interference from compound fluorescence
β-arrestin recruitment1536 wells/plateEnzyme complementation or BRETRobust Z' factors, fewer false positivesMay miss G-protein biased ligands

Implementation considerations include:

  • Compound library design focused on pheromone-like chemical space

  • Tiered screening approach with primary assays followed by orthogonal confirmation

  • Informatics infrastructure to handle complex kinetic data

  • Machine learning algorithms to identify structure-activity relationships

  • Counter-screening against related receptors to establish selectivity profiles

Automated liquid handling systems and integrated robotic platforms can significantly increase throughput while reducing variability between experimental batches .

How can CRISPR-Cas9 gene editing be optimized for studying Vmn1r41 function in vivo?

CRISPR-Cas9 technology offers powerful approaches for investigating Vmn1r41 function in vivo. Optimized methodologies include:

  • Guide RNA Design and Validation:

    • Utilize algorithms incorporating on-target efficiency and off-target prediction

    • Design multiple sgRNAs targeting different exons of Vmn1r41

    • Validate sgRNA efficiency in rat cell lines before in vivo application

    • Implement careful off-target analysis through whole-genome sequencing

  • Delivery Methods for VNO-specific Editing:

    • AAV-mediated delivery optimized for vomeronasal tissue tropism

    • Electroporation of VNO tissue in neonatal rats

    • Lentiviral vectors with VNO-specific promoters

    • Ex vivo editing of VNO progenitor cells followed by transplantation

  • Genetic Modification Strategies:

    • Complete knockout through frameshift indels in early exons

    • Knock-in of reporter genes (GFP, RFP) for lineage tracing

    • Introduction of point mutations to investigate specific receptor domains

    • Conditional knockout using Cre-loxP systems with VNO-specific promoters

  • Phenotypic Analysis Methods:

    • Electrophysiological characterization of VNO responses

    • Calcium imaging of isolated VNO preparations

    • Behavioral assays specific to pheromone-mediated behaviors

    • Transcriptomic analysis of VNO neurons following receptor modification

The editing efficiency in primary VNO tissue typically ranges from 40-75% depending on delivery method and target site accessibility. Researchers should implement careful controls including sequencing validation of edits, off-target analysis, and comparison with traditional knockout models when available .

What are the best computational approaches for predicting Vmn1r41-ligand interactions?

Computational prediction of Vmn1r41-ligand interactions requires specialized approaches that account for the unique structural characteristics of vomeronasal receptors. Recommended methodologies include:

  • Homology Modeling and Structure Refinement:

    • Template selection from structurally characterized GPCRs (typically class A)

    • Multiple template approach combining different activation states

    • Extensive conformational sampling using Rosetta membrane or MODELLER

    • Refinement through molecular dynamics simulations in explicit lipid bilayers

  • Binding Site Identification:

    • ConSurf evolutionary conservation analysis

    • SiteMap or FTMap computational solvent mapping

    • GRID-based hotspot identification

    • Machine learning algorithms trained on known GPCR binding pockets

  • Virtual Screening Workflows:

    • Pharmacophore modeling based on putative pheromone ligands

    • Molecular docking using receptor ensemble approaches

    • MM-GBSA or FEP calculations for binding energy estimation

    • Machine learning models trained on vomeronasal receptor-ligand data

  • Molecular Dynamics Simulations:

    • Conventional MD simulations (typically 500ns-1μs)

    • Enhanced sampling methods (metadynamics, accelerated MD)

    • Coarse-grained simulations for larger-scale conformational changes

    • Markov State Models for extracting kinetic information

Performance metrics from validated GPCR studies suggest an enrichment factor of 5-10 in virtual screening campaigns and binding pose prediction accuracy within 2-3Å RMSD for well-characterized systems. Researchers should implement consensus scoring approaches combining multiple computational methods to increase prediction reliability .

How does Vmn1r41 function compare to other vomeronasal receptors in different species?

Comparative analysis of Vmn1r41 across species reveals important evolutionary insights and functional differences:

SpeciesReceptor HomologSequence Identity to Rat Vmn1r41Key Functional DifferencesSignaling Pathway Variations
MouseVmn1r41~88%Broader ligand specificity profileSimilar Gαi2 coupling
HumanPseudogene (non-functional)~45% (fragmentary)Not expressed functionallyN/A
DogV1R8~58%Expanded recognition of volatile carboxylic acidsEnhanced coupling to calcium signaling
PigV1R-like~62%Higher specificity for steroid derivativesAdditional coupling to Gαq pathway

Evolutionary analysis indicates that Vmn1r41 belongs to an ancient clade of vomeronasal receptors that underwent significant diversification in rodents. The receptor shows highest conservation in the transmembrane domains and intracellular loops involved in G-protein coupling, while extracellular regions show greater variability, likely reflecting species-specific adaptation to different pheromone cues.

In rodents, Vmn1r41 expression patterns differ slightly between rats and mice, with rat Vmn1r41 showing more restricted expression in the apical zone of the VNO. This topographical difference correlates with specialized detection of species-specific social cues .

What methodological approaches can resolve contradictions in Vmn1r41 expression studies?

Contradictions in Vmn1r41 expression studies often arise from methodological differences and biological variability. A systematic approach to resolving these discrepancies includes:

  • Standardized Detection Methods:

    • Develop validated antibodies with demonstrated specificity

    • Design isoform-specific qPCR primers with careful validation

    • Implement RNAscope in situ hybridization for single-cell resolution

    • Create reporter lines using CRISPR knock-in strategies

  • Comprehensive Sampling Design:

    • Account for age-dependent expression variations (neonatal to adult)

    • Analyze sex-specific differences systematically

    • Consider estrous cycle stage in female subjects

    • Examine strain-specific variations in laboratory rats

  • Multi-method Validation:

    • Correlate protein detection (immunohistochemistry) with mRNA localization

    • Verify expression using both bulk and single-cell RNA sequencing

    • Implement Western blot analysis with multiple antibodies

    • Utilize functional calcium imaging to confirm expression in responding neurons

  • Quantitative Analysis Framework:

    • Establish standardized quantification methods (cells/mm², intensity normalization)

    • Implement blinded analysis to prevent experimenter bias

    • Utilize automated image analysis algorithms to reduce subjectivity

    • Conduct proper statistical analysis with appropriate sample sizes (minimum n=6 animals)

By implementing this integrated approach, researchers can distinguish true biological variability from technical artifacts. Key findings should be validated across at least three independent methodologies to establish consensus on Vmn1r41 expression patterns .

How can findings from Vmn1r41 research be applied to broader neuroscience questions?

Research on Vmn1r41 extends beyond vomeronasal biology, offering insights into fundamental neuroscience concepts:

  • Neural Circuit Mapping and Function:

    • Vmn1r41-expressing neurons can serve as entry points for circuit tracing

    • Optogenetic activation of these neurons helps define behavioral circuits

    • Comparative analysis of Vmn1r41 circuits across species informs evolutionary neurobiology

    • Understanding how chemosensory information integrates with other sensory modalities

  • Receptor-Ligand Biology Principles:

    • Insights into GPCR dynamics from Vmn1r41 conformational studies

    • Understanding ligand selectivity determinants applicable to drug design

    • Models of signal integration when multiple receptors are activated

    • Principles of receptor adaptation and sensitization

  • Behavioral Neuroscience Applications:

    • Window into innate versus learned behaviors

    • Understanding neural mechanisms of social recognition

    • Insights into stress effects on chemosensory processing

    • Models for studying sensory-driven behavioral decision-making

  • Methodological Advances:

    • Development of biosensors based on receptor mechanisms

    • Innovative approaches to expressing challenging membrane proteins

    • Computational techniques for predicting receptor-ligand interactions

    • High-throughput functional screening methodologies

Translational applications include development of novel biosensors for environmental chemical detection, potential therapeutic approaches for disorders involving chemosensation, and agricultural applications in pest control through understanding species-specific chemical communication .

What are the most common technical challenges when working with recombinant Vmn1r41 and how can they be addressed?

Working with recombinant Vmn1r41 presents several technical challenges that researchers should anticipate and address:

ChallengeUnderlying CausesTroubleshooting Strategies
Low expression yieldProtein toxicity to host cells, inefficient translationUse inducible expression systems, optimize codon usage, lower induction temperature, supplement with chaperones
Protein aggregationHydrophobic transmembrane domains, improper foldingAdd stabilizing agents (glycerol, specific lipids), use fusion partners (SUMO, MBP), optimize detergent selection
Loss of functionalityDenaturation during purification, missing post-translational modificationsGentle purification procedures, maintain critical lipid environment, consider native-like nanodiscs or liposomes
Inconsistent assay resultsVariation in receptor density, heterogeneous glycosylationQuantify surface expression, normalize data to expression levels, implement quality control checkpoints
Non-specific binding in assaysHydrophobic nature of receptor, aggregationOptimize blocking agents, include appropriate controls, validate with multiple assay formats

Additionally, researchers should consider:

  • Starting with larger culture volumes to compensate for low yields (typically 4-10 liters)

  • Implementing rigorous quality control at each purification step

  • Developing sensitive analytical methods to verify proper folding (e.g., circular dichroism)

  • Creating standardized batches of receptor preparation for long-term studies

These approaches can significantly improve reproducibility and success rates when working with this challenging receptor protein .

How can researchers optimize storage and handling conditions for maintaining Vmn1r41 stability?

Maintaining the stability and functionality of recombinant Vmn1r41 requires careful attention to storage and handling conditions:

  • Storage Buffer Optimization:

    • pH optimization (typically 7.0-7.5 for maximal stability)

    • Buffer composition (Tris-based buffers with 50% glycerol recommended)

    • Addition of specific stabilizing agents:

      • 150-300 mM NaCl to maintain ionic strength

      • 5-10% glycerol as cryoprotectant

      • 1-5 mM reducing agent (DTT or β-mercaptoethanol)

      • Protease inhibitor cocktail

  • Temperature Considerations:

    • Short-term storage (1-2 weeks): 4°C with minimal freeze-thaw cycles

    • Medium-term storage (1-3 months): -20°C in aliquots to avoid repeated freezing

    • Long-term storage (>3 months): -80°C with controlled rate freezing

    • Working aliquots should never undergo more than 3 freeze-thaw cycles

  • Physical Handling Guidelines:

    • Avoid vigorous vortexing that can cause protein denaturation

    • Use low-binding microcentrifuge tubes to prevent adsorption

    • Implement sterile technique to prevent microbial contamination

    • Minimize exposure to strong light sources

  • Stability Monitoring Protocols:

    • Implement regular quality control testing of stored samples

    • Develop functional assays to verify activity retention

    • Use size exclusion chromatography to monitor aggregation state

    • Consider thermal shift assays to track stability changes over time

Researchers should conduct stability studies under different conditions to determine optimal storage parameters for their specific recombinant Vmn1r41 preparation. Empirical data suggests that protein activity typically decreases by 10-15% per month at -20°C and by 3-5% per month at -80°C .

What analytical methods are most effective for verifying the structural integrity of recombinant Vmn1r41?

Comprehensive assessment of recombinant Vmn1r41 structural integrity requires multiple complementary analytical techniques:

  • Chromatographic Methods:

    • Size exclusion chromatography (SEC) to assess aggregation state and homogeneity

    • Reverse-phase HPLC to evaluate hydrophobicity profiles

    • Ion exchange chromatography to detect charge variants

    • Analytical ultracentrifugation for precise molecular weight determination

  • Spectroscopic Techniques:

    • Circular dichroism (CD) to analyze secondary structure elements

    • Fluorescence spectroscopy to assess tertiary structure

    • Fourier-transform infrared spectroscopy (FTIR) for secondary structure

    • Nuclear magnetic resonance (NMR) for residue-specific structural information

  • Mass Spectrometry Approaches:

    • Intact mass analysis to confirm protein identity and modifications

    • Peptide mapping to verify sequence coverage

    • Hydrogen-deuterium exchange MS to probe structural dynamics

    • Cross-linking MS to assess tertiary structure contacts

  • Functional and Biophysical Assays:

    • Thermal shift assays to determine stability and ligand binding

    • Surface plasmon resonance for ligand binding kinetics

    • Microscale thermophoresis for protein-ligand interactions

    • Ligand-induced conformational change assays

Data from these techniques should be integrated to build a comprehensive picture of protein structural integrity. Critical quality attributes include: monodispersity (>90% by SEC), correct secondary structure content (α-helical content of 45-55% by CD), thermal stability (melting temperature ≥45°C), and retained ligand binding activity (within 80% of reference standard) .

What emerging technologies show promise for advancing Vmn1r41 research?

Several cutting-edge technologies are poised to revolutionize Vmn1r41 research:

  • Advanced Structural Biology Approaches:

    • Cryo-electron microscopy for near-atomic resolution structures without crystallization

    • Micro-electron diffraction (MicroED) for structure determination from nanocrystals

    • Serial femtosecond crystallography using X-ray free electron lasers

    • Integrative structural biology combining multiple data sources

  • Single-Cell Technologies:

    • Single-cell RNA sequencing to identify Vmn1r41-expressing cell populations

    • Spatial transcriptomics to map receptor expression in tissue context

    • Mass cytometry for high-dimensional protein profiling

    • Patch-seq combining electrophysiology with transcriptomics

  • Advanced Genetic Engineering:

    • Base editing for precise nucleotide changes without double-strand breaks

    • Prime editing for targeted insertions and deletions

    • Conditional and cell-type-specific CRISPR systems

    • Synthetic biology approaches for artificial signaling circuits

  • Computational and AI Approaches:

    • Deep learning for structure prediction and ligand discovery

    • Molecular dynamics simulations on exascale computing platforms

    • Graph neural networks for modeling protein-ligand interactions

    • Quantum computing applications for binding energy calculations

These technologies will enable unprecedented insights into Vmn1r41 structure-function relationships, expression patterns, and in vivo roles. Integration of computational approaches with experimental validation will be particularly powerful for accelerating discovery in this field .

How might systems biology approaches enhance understanding of Vmn1r41 in the broader context of chemosensory networks?

Systems biology approaches offer powerful frameworks for understanding Vmn1r41 within the complex chemosensory system:

  • Multi-omics Integration:

    • Combine transcriptomics, proteomics, and metabolomics data from VNO tissue

    • Correlate Vmn1r41 expression with broader gene regulatory networks

    • Identify protein interaction networks through proximity labeling approaches

    • Map metabolic changes in response to receptor activation

  • Network Modeling and Analysis:

    • Construct signaling network models incorporating Vmn1r41 pathways

    • Apply graph theory to understand information flow in chemosensory circuits

    • Develop ordinary differential equation models of receptor activation dynamics

    • Implement Boolean network models for qualitative system behavior

  • Multi-scale Integration:

    • Link molecular events (receptor binding) to cellular responses (calcium signaling)

    • Connect cellular activity to neural circuit activation

    • Relate circuit dynamics to behavioral outputs

    • Develop hierarchical models spanning molecular to behavioral scales

  • Comparative Systems Approaches:

    • Analyze Vmn1r41 networks across species to identify conserved modules

    • Compare chemosensory system architecture across sensory modalities

    • Examine evolutionary conservation and divergence of signaling pathways

    • Identify principles of chemosensory coding through cross-species comparison

Implementation of these approaches requires large-scale data collection efforts and sophisticated computational frameworks. Successful examples in other GPCR systems suggest that network-level understanding can reveal emergent properties not apparent from reductionist approaches .

What interdisciplinary collaborations would most benefit future Vmn1r41 research?

Advancing Vmn1r41 research requires strategic interdisciplinary collaborations that bring together diverse expertise:

Discipline CombinationResearch OpportunitiesPotential Breakthrough Areas
Structural Biology + Computational ChemistryHigh-resolution structures and ligand binding mechanismsAtomic-level understanding of pheromone recognition
Neuroscience + Behavioral EcologyLinking receptor activation to natural behaviorsDecoding the neural basis of social communication
Systems Biology + BioinformaticsNetwork-level understanding of receptor signalingIdentifying emergent properties in chemosensory coding
Protein Engineering + Biosensor DevelopmentCreation of Vmn1r41-based detection systemsEnvironmental sensors for specific chemical compounds
Evolutionary Biology + GenomicsTracing receptor evolution across speciesUnderstanding adaptation of chemosensory systems
Chemical Ecology + Analytical ChemistryIdentification of natural ligandsDiscovery of novel pheromone compounds
Immunology + NeuroendocrinologyIntersection of immune and chemosensory systemsMechanisms of environmental sensing in health and disease

Successful collaborations require addressing challenges in methodology standardization, data sharing, and interdisciplinary communication. Establishing shared resources (e.g., antibodies, cell lines, animal models) and common experimental protocols can facilitate productive collaborative research. Interdisciplinary training programs and workshops focused on Vmn1r41 and related chemosensory receptors would foster the next generation of researchers equipped to tackle complex questions across traditional disciplinary boundaries .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.