Recombinant Rat Vomeronasal type-1 receptor 51 (Vmn1r51)

Shipped with Ice Packs
In Stock

Description

Definition and Basic Properties

Vmn1r51 belongs to the V1r family of vomeronasal receptors, which are G protein-coupled receptors (GPCRs) specialized in detecting pheromones and other chemical cues linked to social and reproductive behaviors . It is encoded by the Vmn1r51 gene and shares homology with other V1r receptors, which are expressed in the apical regions of the VNO .

Key Properties:

PropertyDetailsSource
Uniprot IDQ62850
Source OrganismRattus norvegicus (Rat)
Protein LengthPartial (1–311 amino acids in full-length variants)
TagsN-terminal 10xHis-tag (common) or AviTag (for biotinylation)
Purity>85% (SDS-PAGE verified)
Expression SystemsE. coli, Yeast, Baculovirus, or Mammalian cells

Production and Biochemical Characteristics

Vmn1r51 is synthesized using recombinant DNA technology, often in E. coli or other expression systems. Key production details include:

Production Variants:

Product CodeSource OrganismTag TypeConjugate
CSB-EP723479RA1E. coliUndeterminedNone
CSB-EP723479RA1-BE. coliAviTagBiotinylated
CSB-CF723479RAE. coliN-terminal 10xHisNone
CSB-YP723479RA1YeastUndeterminedNone

Biochemical Notes:

  • Reconstitution: Reconstituted in deionized sterile water (0.1–1.0 mg/mL) with 5–50% glycerol for stabilization .

  • Reactivity: Primarily tested in rat species; cross-reactivity with mouse homologs (e.g., Vmn1r51) is noted but not fully characterized .

Functional Role and Research Applications

Vmn1r51 is implicated in pheromone detection and social behavior regulation:

Functional Insights:

  • VNO Expression: Expressed in the apical region of the VNO, where it couples with Gαi proteins to mediate inositol trisphosphate signaling .

  • Pheromone Response: Transcriptome studies in rats (Rattus norvegicus) identified Vmn1r51 as differentially expressed in response to pheromonal cues, suggesting a role in interspecies recognition or reproductive signaling .

Applications in Research:

ApplicationMethodPurpose
ELISABinding assaysQuantify receptor-ligand interactions
Western BlotImmunodetectionValidate expression in tissues/cells
siRNA KnockdownLentiviral vectorsStudy loss-of-function phenotypes

Research Findings and Significance

Recent studies highlight Vmn1r51’s role in pheromone-mediated behaviors:

  • Transcriptome Analysis: RNA sequencing of Rattus norvegicus identified Vmn1r51 among V1r genes enriched in pheromone-responsive pathways, including "response to organic substances" .

  • Species-Specific Expression: Vmn1r51 homologs in mice are used in siRNA studies to investigate receptor-specific signaling, though rat-specific studies remain limited .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, should you have a specific format requirement, please indicate it during order placement, and we will accommodate your request.
Lead Time
Delivery times may vary depending on the purchase method and location. For specific delivery estimates, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipment is required, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, we recommend briefly centrifuging the vial to concentrate the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We advise adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol final concentration is 50%. Customers can use this as a reference point.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein itself.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. The lyophilized form maintains its stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is necessary. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Vom1r105; Vmn1r51; Vnr1; Vomeronasal type-1 receptor 105; Pheromone receptor VN1; Vomeronasal type-1 receptor 51; Vomeronasal type-1 receptor A1; Vomeronasal receptor 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-311
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Vom1r105
Target Protein Sequence
MMNKNSRLYTDSNIRNTFFAEIGIGVSANSLLLLFNIFKLICGQRSRLTDLPIGLLSLIN LLMLLMTAFIATDTFISWRGWDDIICKSLLYLYRTFRGLSLCTSCLLSVLQAIILSPRSS CLAKFKHKPSHHISCAILSLSVLYMFISSHLLVSIIATPNLTTNDFIHVTQWCSILPMSY LMQSMFSTLLAIRDVFLISLMVLSTWYMVALLCRHRKQTRHLQGTSLSPKASPEQRATRS ILMLMSLFVLMSVFDSIVCSSRTMYLNDPISYSYQLFMVHIYATVSPFVFIVTEKHIVNS LRSMCVKVMNV
Uniprot No.

Target Background

Function
This receptor is a putative pheromone receptor implicated in the regulation of social and reproductive behaviors.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in 1-4% of neurons of the vomeronasal organ. Only one pheromone receptor gene may be expressed in a particular neuron. Not expressed in the main olfactory epithelium.

Q&A

What is Vmn1r51 and what is its role in rodent sensory systems?

Vmn1r51 is a member of the V1r gene family of vomeronasal receptors expressed in vomeronasal sensory neurons (VSNs) of rats. It functions as a chemosensory receptor that detects pheromones and other chemical signals essential for social and reproductive behaviors. The receptor is part of the highly evolutionarily dynamic V1r gene superfamily that enables rodents to perceive chemical signals from their environment . Vmn1r51 and other V1r receptors are typically expressed in apically located vomeronasal neurons that co-express the G-protein subunit Gαi2, distinguishing them from V2r-expressing neurons that express Gαo . This receptor contributes to the remarkable ability of rodents to detect species-specific and individual-specific chemical cues governing mate selection, territorial behavior, and other social interactions.

How does the genomic organization of Vmn1r51 compare to other vomeronasal receptors?

Vmn1r51, like most functional V1r genes, is typically found within gene clusters rather than as an isolated gene unit. Research has shown that functional vomeronasal receptor genes maintain a conserved clustered organization across mammalian species . Genomic analysis reveals that while many V1r pseudogenes are scattered throughout mammalian genomes, functional V1r genes like Vmn1r51 tend to be clustered together on specific chromosomal regions . This clustering appears to be evolutionarily conserved due to transcription-stabilizing elements associated with the clusters rather than with individual gene units. The rat reference genome assembly (mRatBN7.2) has significantly improved our ability to accurately map and understand these genomic arrangements, with a 290-fold increase in contiguity compared to previous assemblies, allowing for more precise localization of Vmn1r51 and related genes .

What factors should be considered when designing experiments involving Vmn1r51?

When designing experiments involving Vmn1r51, researchers should carefully consider several key experimental factors:

  • Selection of explanatory factors: Determine which variables might influence Vmn1r51 expression or function, such as developmental stage, sex, environmental conditions, or genetic background .

  • Response variables: Clearly define measurable outcomes, such as receptor expression levels, signaling activity, neuronal activation patterns, or behavioral responses .

  • Experimental units: Carefully select the appropriate animal models, cell lines, or tissue preparations based on research questions. When using rats, consider strain differences and genetic diversity that might affect Vmn1r51 function .

  • Randomization and blocking: Implement proper randomization to control for confounding variables and consider blocking designs to account for known sources of variation like age or litter effects .

  • Sample size and replication: Ensure sufficient statistical power through adequate sample sizes and biological replicates, particularly given the high variability often observed in neuronal gene expression .

  • Genetic background considerations: With the improved rat reference genome (mRatBN7.2), researchers should account for strain-specific variations that might affect Vmn1r51 structure or expression, as over 20 million sequence variations have been identified across rat strains .

How can researchers effectively validate the specificity of antibodies or probes for Vmn1r51?

Validating antibodies or probes for Vmn1r51 requires a multi-faceted approach to ensure specificity and reliability:

  • Sequence verification: Begin with in silico analysis comparing the target sequence of Vmn1r51 with other V1r family members to identify unique regions suitable for antibody generation or probe design .

  • Positive controls: Use recombinant Vmn1r51 protein as a positive control for antibody validation. Commercial ELISA kits for recombinant rat Vmn1r51 may be available for this purpose .

  • Negative controls: Employ tissues from knockout models (if available) or tissues known not to express Vmn1r51 as negative controls.

  • Cross-reactivity testing: Test antibodies against related V1r family members to ensure they don't cross-react, particularly important given the high sequence similarity among vomeronasal receptors .

  • Immunohistochemical validation: Confirm proper localization to vomeronasal sensory neurons, specifically in the apical zone of the vomeronasal organ where V1r receptors are typically expressed .

  • Western blot analysis: Verify the observed molecular weight matches the predicted size of Vmn1r51.

  • RNA verification methods: Complement protein detection with RNA detection methods such as in situ hybridization or RT-PCR using primers specific to Vmn1r51, comparing results with antibody localization patterns.

What approaches can be used to study the functional properties of Vmn1r51?

Studying the functional properties of Vmn1r51 requires specialized techniques that address its role in pheromone detection:

  • Calcium imaging: Monitor intracellular calcium fluctuations in isolated vomeronasal neurons or heterologous expression systems expressing Vmn1r51 in response to potential ligands.

  • Electrophysiological recordings: Use patch-clamp techniques to measure electrical responses of Vmn1r51-expressing neurons to candidate ligands.

  • Transgenic reporter systems: Generate transgenic rat lines where Vmn1r51 expression is coupled to fluorescent reporters like those used in Fpr-rs3 studies, allowing visualization of neurons expressing the receptor .

  • CRISPR/Cas9 gene editing: Create knockout or knockin models to study the effects of Vmn1r51 deletion or modification on pheromone detection and social behaviors.

  • Heterologous expression systems: Express Vmn1r51 in cell lines with appropriate G-protein machinery to screen for activating ligands using reporter gene assays.

  • Ex vivo preparation: Develop slice preparations of the vomeronasal organ to study neuronal responses in a more physiologically relevant context while maintaining controlled experimental conditions.

  • Behavioral assays: Design ethologically relevant behavioral tests to assess the impact of Vmn1r51 manipulation on social recognition, mate preference, and other pheromone-mediated behaviors.

How does genomic context affect the transcription of Vmn1r51?

The genomic context significantly influences Vmn1r51 transcription, as demonstrated by several key findings from vomeronasal receptor research:

  • Cluster-dependent expression: Vmn1r51, like other V1r genes, shows expression patterns that are influenced by its position within a gene cluster. Genes within certain clusters demonstrate significantly higher transcription levels than those in other clusters .

  • Regulatory elements beyond promoters: While individual V1r genes have their own promoters, research on vomeronasal Fpr genes has shown that the 400-bp segment upstream of the transcriptional start site is insufficient for stable gene expression, suggesting additional regulatory elements play important roles .

  • Cluster-associated stabilizing elements: Studies using transgenic approaches reveal that removing a vomeronasal receptor gene from its native cluster results in only transient expression, indicating that cluster-associated elements are crucial for transcriptional stability rather than just initial gene choice .

  • Pseudogene expression correlation: V1r pseudogenes located near functional gene clusters show higher expression levels than isolated pseudogenes, further supporting the idea that cluster-specific regulatory elements influence transcription beyond individual gene units .

  • Long-range chromatin interactions: The clustering organization likely facilitates specific three-dimensional chromatin structures that promote stable expression, though the precise mechanisms remain to be fully elucidated.

What genetic variations of Vmn1r51 exist across different rat strains and how might they affect function?

Genetic variations in Vmn1r51 across rat strains represent an important dimension of research, especially with improved genomic resources:

  • Strain-specific sequence variations: The analysis of 163 whole-genome sequencing datasets representing 120 laboratory rat strains has identified approximately 20 million sequence variations across the rat genome . While specific Vmn1r51 variations are not detailed in the provided materials, this extensive catalog of genetic diversity likely includes variations in this gene.

  • Functional impact prediction: Among the identified variations across the rat genome, approximately 18,700 are predicted to potentially impact the function of 6,677 genes . Such variations in Vmn1r51 could affect ligand binding specificity, receptor trafficking, or signaling efficiency.

  • Evolutionary implications: Vomeronasal receptor genes are known to be highly evolutionarily dynamic, suggesting that strain differences in Vmn1r51 may reflect adaptations to different environmental or laboratory conditions .

  • Improved detection with new reference genome: The mRatBN7.2 reference genome provides 9-fold reduction in base-level errors compared to previous assemblies, enabling more accurate identification of genetic variations in genes like Vmn1r51 .

  • Phenotypic correlations: Differences in Vmn1r51 sequence or expression between rat strains may correlate with strain-specific behaviors or pheromone sensitivities, though such correlations would require dedicated phenotypic studies.

How can single-cell RNA sequencing be applied to study Vmn1r51 expression patterns?

Single-cell RNA sequencing (scRNA-seq) offers powerful approaches for investigating Vmn1r51 expression patterns in vomeronasal neurons:

  • Cell-specific expression profiling: scRNA-seq allows researchers to determine the exact proportion of vomeronasal sensory neurons expressing Vmn1r51 compared to other vomeronasal receptors, providing insights into the probability of gene choice .

  • Co-expression analysis: This technique can reveal whether Vmn1r51 follows the "one neuron-one receptor" rule typical of vomeronasal receptors or if it shows any atypical co-expression with other receptors .

  • Developmental trajectories: By analyzing cells at different developmental stages, researchers can track when and how Vmn1r51 expression is established, maintained, or potentially altered over time.

  • Correlation with whole-tissue expression: As demonstrated with other V1r genes, the number of neurons expressing a specific receptor correlates with mRNA levels detected in whole-tissue RNA-seq, allowing validation across methods .

  • Identification of supporting genes: scRNA-seq can identify genes co-expressed with Vmn1r51 that might be involved in its function, trafficking, or signaling pathways.

  • Spatial inference: While traditional scRNA-seq loses spatial information, computational approaches can infer the spatial distribution of Vmn1r51-expressing neurons within the vomeronasal organ.

  • Integration with genetic variations: Combined with genotyping data, scRNA-seq can reveal how genetic variations across rat strains affect the expression pattern of Vmn1r51 .

How can transgenic approaches be used to study Vmn1r51 function in vivo?

Transgenic approaches offer sophisticated tools for investigating Vmn1r51 function in living organisms:

  • Knockin reporter lines: Following the model used for Fpr-rs3, researchers can generate knockin rat lines where a polycistronic cassette is added to Vmn1r51, enabling co-expression of fluorescent proteins and Cre recombinase without disrupting the receptor's function .

  • Promoter characterization: Transgenic constructs with different segments of the Vmn1r51 promoter region can help identify critical regulatory elements, similar to studies with the conserved 400-bp segment upstream of vomeronasal Fpr genes .

  • Large construct transgenesis: Given the importance of genomic context for vomeronasal receptor expression, large transgenic constructs (>100kb) containing Vmn1r51 and surrounding sequences can be used to preserve native regulatory elements .

  • Cre-dependent tracing: By combining Vmn1r51-driven Cre expression with reporter lines like Rosa-stopRFP, researchers can visualize the axonal projections of Vmn1r51-expressing neurons to their targets in the accessory olfactory bulb .

  • Conditional ablation: Using diphtheria toxin receptor or other conditional ablation systems, researchers can selectively eliminate Vmn1r51-expressing neurons to study their behavioral significance.

  • Optogenetic and chemogenetic manipulation: These approaches allow for precise temporal control of Vmn1r51-expressing neurons' activity to assess their causal role in pheromone-mediated behaviors.

What are the challenges and solutions in expressing functional recombinant Vmn1r51 for structural studies?

Expressing functional recombinant Vmn1r51 for structural studies presents several challenges with corresponding potential solutions:

  • Membrane protein expression challenges:

    • Challenge: As a seven-transmembrane receptor, Vmn1r51 is difficult to express in standard expression systems.

    • Solution: Use specialized expression systems like baculovirus-infected insect cells, mammalian cell lines optimized for GPCR expression, or cell-free systems supplemented with lipid nanodiscs.

  • Protein stability issues:

    • Challenge: Vomeronasal receptors often show poor stability when extracted from their native membrane environment.

    • Solution: Employ receptor engineering approaches like thermostabilizing mutations, fusion with stabilizing protein partners (e.g., T4 lysozyme), or antibody fragments that lock the receptor in a stable conformation.

  • Correct folding verification:

    • Challenge: Ensuring proper folding of recombinant Vmn1r51 is difficult without known ligands.

    • Solution: Develop binding assays using predicted ligands or monoclonal antibodies that recognize conformational epitopes.

  • Crystallization difficulties:

    • Challenge: Membrane proteins like Vmn1r51 are notoriously difficult to crystallize.

    • Solution: Consider alternative structural determination methods such as cryo-electron microscopy, which has revolutionized GPCR structural biology.

  • Ligand identification:

    • Challenge: Without known ligands, it's difficult to stabilize Vmn1r51 in a specific conformational state.

    • Solution: Conduct systematic screening of candidate pheromones using functional assays prior to structural studies.

How can the improved rat reference genome (mRatBN7.2) enhance research on Vmn1r51?

The mRatBN7.2 reference genome provides several advantages for Vmn1r51 research:

  • Improved sequence accuracy: With a 9-fold reduction in base-level errors compared to previous assemblies, researchers can have greater confidence in the Vmn1r51 sequence and its genomic context .

  • Enhanced contiguity: The dramatic 290-fold increase in contiguity (contig N50 improved from ~100 Kb to 29.2 Mb) allows better characterization of the genomic neighborhood of Vmn1r51, including potential long-range regulatory elements .

  • More complete gene annotations: The improved assembly has led to more complete gene annotations, which is particularly valuable for genes like Vmn1r51 that belong to large, complex gene families .

  • Better variant detection: Researchers can more accurately identify genetic variations in Vmn1r51 across rat strains, with approximately 20 million sequence variations now cataloged across 120 laboratory rat strains .

  • Improved mapping precision: The enhanced reference genome significantly improves the mapping precision of genomic, transcriptomic, and proteomics data, allowing for more reliable analysis of Vmn1r51 expression and function .

  • Transcriptional feature annotation: The new reference includes annotations of transcription start sites and alternative polyadenylation sites, providing insights into the transcriptional regulation of Vmn1r51 .

  • Enhanced genetic mapping: A new rat genetic map with 150,835 markers enables better genetic association studies involving Vmn1r51 and related phenotypes .

What are common pitfalls in analyzing Vmn1r51 expression and how can they be avoided?

Research on Vmn1r51 expression can encounter several challenges that require specific methodological considerations:

  • Pseudogene cross-reactivity:

    • Pitfall: PCR primers or probes might amplify or hybridize to pseudogenes or closely related V1r family members.

    • Solution: Design oligonucleotides at unique exon-exon junctions and validate specificity using positive and negative controls .

  • Low expression levels:

    • Pitfall: Vomeronasal receptors typically show low expression levels, making detection challenging.

    • Solution: Use sensitive methods like RNAscope, droplet digital PCR, or nested PCR approaches; single-cell analysis may be necessary to detect expression in individual neurons .

  • Cluster effects misinterpretation:

    • Pitfall: Attributing expression changes to the receptor itself rather than its genomic context.

    • Solution: Compare expression of Vmn1r51 in its native context versus when transgenically relocated to distinguish intrinsic properties from cluster-dependent effects .

  • Reference genome mapping errors:

    • Pitfall: Using outdated reference genomes can lead to mapping errors for Vmn1r51 reads.

    • Solution: Utilize the latest rat reference genome (mRatBN7.2) which offers significantly improved mapping precision for complex gene families .

  • Developmental timing:

    • Pitfall: Focusing on a single developmental timepoint may miss dynamic expression patterns.

    • Solution: Examine multiple developmental stages, as some vomeronasal receptors show transient expression patterns that stabilize later in development .

How can researchers effectively design primers for Vmn1r51 detection and quantification?

Designing effective primers for Vmn1r51 requires careful consideration of several factors:

  • Sequence uniqueness:

    • Thoroughly compare Vmn1r51 sequence against other V1r family members to identify unique regions.

    • Target regions with at least 3-4 mismatches to the closest related sequence, preferably including mismatches at the 3' end of primers.

  • Exon-exon junctions:

    • Design primers that span exon-exon junctions to avoid amplification of genomic DNA.

    • This approach is particularly important given the intronless nature of many vomeronasal receptor genes.

  • Amplicon length optimization:

    • For RT-qPCR, design amplicons of 70-150 bp for optimal amplification efficiency.

    • For conventional PCR, longer amplicons (300-800 bp) may be suitable for distinguishing between closely related family members.

  • GC content and melting temperature:

    • Aim for primers with 40-60% GC content and similar melting temperatures (within 2°C of each other).

    • Avoid sequences prone to secondary structure formation or primer-dimer formation.

  • Validation strategy:

    • Test primers against cDNA from vomeronasal tissue (positive control) and non-vomeronasal tissues (negative control).

    • Sequence the amplification products to confirm specificity.

    • Consider using digital PCR for absolute quantification when expression levels are low.

What statistical approaches are appropriate for analyzing Vmn1r51 expression data across different experimental conditions?

Statistical analysis of Vmn1r51 expression requires approaches that account for the unique characteristics of vomeronasal receptor expression data:

  • Normalization strategies:

    • When analyzing bulk RNA sequencing data, use normalization methods that account for the specialized nature of vomeronasal tissue, where a small number of genes may be highly expressed.

    • Consider using multiple reference genes specifically validated for vomeronasal tissue rather than traditional housekeeping genes.

  • Single-cell data analysis:

    • For scRNA-seq data, apply specialized normalization methods that account for the stochastic nature of gene expression and technical dropouts.

    • Use computational approaches that can identify rare cell populations, as Vmn1r51-expressing neurons may represent a small fraction of the total vomeronasal neuron population .

  • Experimental design considerations:

    • Implement proper randomization and blocking designs to control for confounding variables like age, sex, or litter effects .

    • Ensure adequate sample sizes through power analysis, accounting for the typically high variability in vomeronasal receptor expression .

  • Appropriate statistical tests:

    • For comparing expression across conditions, consider non-parametric tests if data do not meet normality assumptions.

    • For complex experimental designs with multiple factors, use mixed-effects models that can account for both fixed and random effects.

    • When comparing expression across different genetic backgrounds, incorporate strain-specific genetic information from the improved rat reference genome .

  • Multiple testing correction:

    • When analyzing multiple vomeronasal receptors simultaneously, implement appropriate multiple testing corrections (e.g., Benjamini-Hochberg FDR) to control for false positives.

    • Consider gene set enrichment approaches that analyze coordinated expression changes across functional groups of vomeronasal receptors.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.