Recombinant Rat Vomeronasal type-1 receptor A16 (V1ra16)

Shipped with Ice Packs
In Stock

Description

Definition and Basic Characteristics

V1ra16 belongs to the V1R family of vomeronasal receptors, which are G protein-coupled receptors (GPCRs) expressed in the vomeronasal organ (VNO) of rodents . The recombinant form is engineered for experimental applications, enabling researchers to study its ligand interactions and signaling mechanisms.

Key Specifications (from product databases ):

PropertyDetail
UniProt IDQ5J3F6
Expression RegionAmino acids 1–310 (full-length protein)
Molecular Weight~35 kDa (predicted)
Storage Conditions-20°C (long-term), 4°C (short-term; avoid freeze-thaw cycles)
Host SystemMammalian cells (exact system unspecified)

Domain Architecture

The receptor features seven transmembrane helices characteristic of class A GPCRs . The extracellular N-terminal domain is critical for ligand binding, while the intracellular loops interact with Gαi2 proteins to mediate signal transduction .

Ligand-Binding Features

Unlike classical MHC molecules, V1Rs like V1ra16 lack a peptide-binding groove but possess an open structure capable of accommodating larger ligands . This aligns with studies showing V1Rs detect small volatile compounds, including sulfated steroids .

Expression and Localization

  • Native Context: V1ra16 is expressed in the apical layer of the VNO sensory epithelium, co-localizing with Gαi2-positive neurons .

  • Recombinant Production: Expressed in mammalian cells (e.g., HEK293-T) for functional assays, as evidenced by calcium imaging and RNA-seq studies .

Functional Role in Pheromone Detection

V1ra16 is implicated in:

  • Intraspecific Communication: Detecting urinary volatiles and major urinary proteins (MUPs) linked to territorial and reproductive behaviors .

  • Ligand Specificity: Preferential activation by sulfated steroids (e.g., corticosterone-21 sulfate) in heterologous systems .

Table 1: Research Findings on V1ra16 and Related V1Rs

Study FocusKey ResultSource
Differential ExpressionV1R genes (e.g., Vom1r68) show subspecies-specific expression in rats
Ligand ActivationV1Rs detect sulfated steroids and MUPs
Signal TransductionCouples with Gαi2 to trigger cAMP inhibition

Applications in Research

  • Behavioral Studies: Used to explore links between pheromone detection and aggression/mating in rodent models .

  • Immunoassays: Commercial ELISA kits employ recombinant V1ra16 to quantify receptor expression levels .

  • Drug Development: Screened for small-molecule modulators targeting vomeronasal signaling pathways .

Evolutionary and Comparative Notes

While primates show reduced V1R functionality, rodents retain a diverse repertoire, with V1ra16 representing a conserved receptor subtype . Pseudogenization events in humans contrast with the functional retention of V1ra16 in rats .

Challenges and Future Directions

  • Ligand Identification: The exact endogenous ligand(s) for V1ra16 remain unconfirmed .

  • Structural Resolution: No crystallography data exists; molecular dynamics simulations could clarify binding mechanics .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for prioritized development.
Synonyms
Vom1r90; V1ra16; Vomeronasal type-1 receptor 90; Pheromone receptor VN6; Vomeronasal receptor 6; Vomeronasal type-1 receptor A16
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Vom1r90
Target Protein Sequence
MRRISTLYGVVDKQAIFFSEVVIGISFNSILFLFHIFQFLLERRLRITDLIISLLALIHL GMLTVMGFRAVDIFASQNVWNDIKCKSLAHLHRLLRGLSLCATCLLSIFQAITLSPRSSC LAKFKYKSTQHSLCSLLVLWAFYMSCGTHYSFTIVADYNFSSRSLIFVTESCIILPMDYI TRHLFFILGIFRDVSFIGLMALSSGYMVALLCRHRKQAQHLHRTSLSPKASPEQRATRTI LLLMSFFVLMYCLDCTISASRLMHNGEPIHHSIQMMVSNSYATLSPLLLIVTENRISRFL KSLLGRTVDA
Uniprot No.

Target Background

Function

Putative pheromone receptor involved in the regulation of both social and reproductive behavior.

Database Links

KEGG: rno:266771

UniGene: Rn.83612

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in 1-4% of neurons of the vomeronasal organ. Only one pheromone receptor gene may be expressed in a particular neuron. Not expressed in the main olfactory epithelium.

Q&A

Advanced Research Questions

  • What methods are most effective for expressing and purifying functional recombinant V1ra16?

Expressing functional recombinant V1ra16 requires specialized techniques due to its nature as a multi-transmembrane GPCR. Based on successful approaches with similar proteins, an effective methodology includes:

  • Vector selection and construct design:

    • Utilize expression vectors with strong promoters suitable for mammalian expression

    • Include appropriate signal peptides for membrane targeting

    • Add purification tags (typically His-tag) at the C-terminus to minimize interference with receptor function

    • Consider codon optimization for the expression system

  • Expression systems:

    • Mammalian cell lines (HEK293, CHO) provide proper post-translational modifications

    • Insect cell systems (Sf9, High Five) often yield higher protein amounts

    • Cell-free systems may be considered for preliminary studies

  • Purification strategy:

    • Solubilize cell membranes using mild detergents that preserve receptor structure

    • Employ immobilized metal affinity chromatography (IMAC) for His-tagged constructs

    • Consider size exclusion chromatography as a polishing step

    • Reconstitute in appropriate buffer systems (Tris-based buffer with 50% glycerol is commonly used)

  • Storage recommendations:

    • Store at -20°C for short-term use

    • Use -80°C for extended storage

    • Avoid repeated freeze-thaw cycles

    • Prepare working aliquots and store at 4°C for up to one week

This approach has been successfully employed for other recombinant rat proteins as documented in the literature .

  • How does evolutionary conservation of V1r receptors inform our understanding of V1ra16 function?

Evolutionary analyses of V1r receptors provide critical insights into their functional significance across species. Studies comparing V1r receptor evolution have revealed several important patterns:

  • Orthology patterns:

    • Rodents typically show low orthology between species (approximately 10% in mice and 16% in rats)

    • In contrast, bats show nearly 100% orthology with their relatives and other laurasiatherians

    • Ruminants (cow, sheep, goat) have conserved V1r repertoires with up to 70% orthology between species

  • Selective pressures:

    • V1r receptors generally exhibit purifying selection, suggesting functional constraint

    • The remarkable conservation of some V1r orthologs across distantly related species (>65 million years) indicates fundamental roles beyond species-specific functions

  • Functional implications for V1ra16:

    • The high degree of conservation in laurasiatherians suggests V1ra16 may mediate innate behaviors common to these species rather than species-specific recognition

    • Sequence conservation implies functions shared by related species while amino acid differences may alter ligand binding properties

    • Conserved V1r receptors connect to brain regions responsible for similar instinctive behaviors across species

This evolutionary perspective challenges the traditional view that V1r receptors primarily function in species recognition and suggests broader roles in conserved behavioral pathways that would include the functional role of V1ra16.

  • What are the challenges in functional expression systems for V1ra16 and how can they be overcome?

Expressing functional V1ra16 presents several technical challenges that researchers must address:

  • Membrane protein expression barriers:

    • Proper folding in heterologous systems

    • Efficient trafficking to the cell membrane

    • Maintaining native conformation in detergent solutions

    • Low expression yields common with GPCRs

  • Solutions and strategies:

    • Fusion partners: Adding well-expressed proteins (e.g., MBP, SUMO) can improve solubility and expression

    • Chaperone co-expression: Co-expressing chaperones like receptor transporting protein 1 (RTP1) and receptor expression enhancing protein 1 (REEP1), which are naturally expressed in the VNO, can significantly increase surface expression

    • Expression system optimization: Testing multiple cell types to identify optimal expression conditions

    • Nanodiscs/proteoliposomes: Reconstituting purified receptors into lipid environments that mimic native membranes

  • Verification methods:

    • Surface expression can be monitored using techniques such as immunocytochemistry with epitope tags

    • Functional verification through calcium imaging or electrophysiological assays

    • Ligand binding assays to confirm proper folding

Studies have shown that RTP1 co-expression can increase surface expression of transmembrane proteins and correlates with increased ATP-stimulated whole-cell current in patch-clamp assays , suggesting this approach may be beneficial for V1ra16 expression.

  • How can researchers resolve contradictions in V1ra16 expression data through context analysis?

Contradictory findings regarding V1ra16 expression and function can be systematically addressed using structured context analysis. Based on established frameworks for resolving apparent contradictions in biomedical literature , researchers should:

  • Identify contextual factors that may explain contradictions:

    • Internal factors: genetic background, sex, age, health status of experimental animals

    • External factors: experimental conditions, housing conditions, diet

    • Methodological differences: detection sensitivity, specificity of reagents, analysis thresholds

    • Model systems: cell lines vs. primary cells vs. in vivo studies

  • Apply structured contradiction analysis using the (α, β, θ) notation :

    • α: number of interdependent variables (e.g., expression level, tissue type, developmental stage)

    • β: number of contradictory dependencies defined by experts

    • θ: minimal number of required Boolean rules to assess contradictions

  • Resolution strategies:

    • Use standardized reporting of experimental conditions

    • Implement meta-analysis approaches to identify patterns across studies

    • Develop Boolean rules to systematically evaluate apparent contradictions

    • Design experiments specifically to test contextual hypotheses that explain contradictions

A systematic review of contradictions in biomedical literature found that most apparent contradictions (from a sample of 58 pairs identified from 2,236 candidates) were due to underspecified context, particularly differences in species, temporal context, and environmental conditions .

  • What are the optimal experimental designs for studying ligand interactions with V1ra16?

Designing robust experiments to study ligand interactions with V1ra16 requires careful consideration of multiple factors:

  • Receptor expression systems:

    • Heterologous expression: Use mammalian cell lines (HEK293, CHO) transfected with V1ra16 and necessary signaling components

    • Native tissue preparation: Utilize freshly isolated VNO tissue for more physiologically relevant conditions

    • Reconstituted systems: Purified receptor in artificial membrane systems (proteoliposomes, nanodiscs)

  • Assay selection based on research questions:

    • Binding assays:

      • Competitive binding assays with labeled reference ligands

      • Surface plasmon resonance for real-time binding kinetics

      • Microscale thermophoresis for interaction studies with minimal protein consumption

    • Functional assays:

      • Calcium imaging to detect signaling activation

      • BRET/FRET assays to monitor conformational changes upon binding

      • Patch-clamp electrophysiology to measure channel activity in the signaling pathway

      • In vivo behavioral assays to correlate molecular interactions with physiological responses

  • Controls and validation:

    • Include known ligands when available

    • Use closely related receptors to assess specificity

    • Include non-transfected cells as negative controls

    • Validate findings through orthogonal methods

  • Ligand libraries:

    • Natural pheromone sources (urine, secretions)

    • Synthetic pheromone candidates

    • Combinatorial chemical libraries

    • Virtual screening followed by validation of top candidates

This multi-faceted approach maximizes the chances of identifying and characterizing authentic ligand interactions while minimizing false positives that can occur with single method approaches.

  • How do structure-function relationships in V1ra16 influence pheromone detection mechanisms?

Understanding the structure-function relationships in V1ra16 is critical for elucidating its role in pheromone detection. While detailed structural information specific to V1ra16 is limited, several approaches can provide insights:

  • Structural analysis:

    • Sequence-based predictions: The V1ra16 sequence (310 amino acids) can be analyzed for structural motifs typical of GPCRs

    • Homology modeling: Using related receptors with known structures as templates

    • Transmembrane topology prediction: Identifying the seven transmembrane domains characteristic of GPCRs

    • Ligand binding pocket analysis: Predicting residues likely involved in ligand interactions

  • Critical functional domains:

    • The N-terminal domain and extracellular loops likely participate in initial ligand recognition

    • Transmembrane domains form the structural core and contain residues critical for signal transduction

    • The third intracellular loop and C-terminal domain mediate G-protein coupling and downstream signaling

  • Structure-guided experimental approaches:

    • Site-directed mutagenesis: Mutating predicted key residues to test functional hypotheses

    • Chimeric receptors: Swapping domains between related receptors to map functional regions

    • Truncation analysis: Testing the role of specific domains through targeted deletions

  • Signaling pathway integration:

    • V1ra16 signals through the TRPC2 channel, which forms protein-protein interactions with scaffolding proteins like Homer

    • Receptor trafficking is facilitated by chaperone proteins such as RTP1 and REEP1

    • Understanding these protein-protein interactions provides insights into how receptor structure influences signaling efficiency

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.