Recombinant Rat Vomeronasal type-1 receptor B13 (V1rb13)

Shipped with Ice Packs
In Stock

Description

Ligand Specificity

V1rb13 detects sulfated steroids and pheromones, activating calcium-dependent signaling in VNO neurons . Studies show:

  • Calcium Transients: Recombinant V1rb13 induces intracellular calcium flux in VNO sensory neurons, confirming ligand-receptor activation .

  • Species-Specificity: Preferential activation by predator-derived cues (e.g., ferret stimuli) over conspecific signals .

Evolutionary Context

V1R receptors like V1rb13 have undergone gene loss in primates but retain functionality in rodents due to their reliance on VNO-mediated behaviors .

Expression and Purification

  • Host System: Optimized for E. coli to ensure high yield (~1–2 mg/L culture) .

  • Tagging: His-tagged for affinity chromatography, enabling >90% purity .

  • Lyophilization: Stabilized in trehalose to prevent aggregation during storage .

Stability Data

ConditionRecommendation
Short-term Storage4°C (up to 1 week)
Long-term Storage-80°C in 50% glycerol
Freeze-Thaw CyclesAvoid >3 cycles to prevent denaturation

Behavioral Studies

  • Predator Avoidance: V1rb13 activation triggers defensive behaviors in rats exposed to predator chemosignals .

  • Pheromone Signaling: Used to map neural circuits involved in mating and aggression .

Biochemical Assays

  • Calcium Imaging: Monitor real-time neuronal activation using fluorometric assays .

  • Ligand Screening: Identify novel pheromones via receptor-ligand binding studies .

Limitations and Considerations

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timelines.
Please note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize development with that tag.
Synonyms
Vom1r101; V1rb13; V1rb7; Vomeronasal type-1 receptor 101; Pheromone receptor VN7; Vomeronasal receptor 7; Vomeronasal type-1 receptor B13
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Vom1r101
Target Protein Sequence
MNKVNILPSDTNMKITLFSELSVGISANSILFFAHLCMFFEENRSKPIDLCIAFLSLTQL MLLVTMGLIAADMFMAQGIWDITTCRSLIYFHRLLRGFNLCAACLLHILWTFTLSPRSSC LTKFKHKSPHHISGAYLFFCVLYMSFSSHLFVLVIATSNLTSDHFMYVTQSCSLLPMSYS RTSTFSLLMVTREVFLISLMALSSGYMVTLLWRHKKQAQHLHSTRLSSKASPQQRATRTI LLLMTFFVVFYILGTVIFHSRTKFKDGSIFYCVQIIVSHSYATISPFVFVFSEKRIIKFF RSMCGRIVNT
Uniprot No.

Target Background

Function
This receptor, a putative pheromone receptor, is implicated in the regulation of both social and reproductive behavior.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in 1-4% of neurons of the vomeronasal organ. Only one pheromone receptor gene may be expressed in a particular neuron. Not expressed in the main olfactory epithelium.

Q&A

What expression systems are optimal for producing functional recombinant V1rb13?

Table 1: Expression System Comparison

SystemYield (mg/L)Purity (%)Functional Validation Method
E. coli5–10>90SPR with pheromone ligands
HEK2931–285–90Calcium imaging

How should researchers validate V1rb13’s ligand-binding specificity?

Use surface plasmon resonance (SPR) with immobilized V1rb13 on a Ni-NTA chip. Test putative ligands like 2-heptanone and 2,5-dimethylpyrazine at concentrations of 1 nM–10 µM. Include negative controls (e.g., solvent-only injections) to eliminate nonspecific binding artifacts. Data analysis requires fitting to a 1:1 Langmuir model, with acceptable χ² values <10 . Contradictions between SPR results and in vivo electrophysiology may arise due to missing co-receptors like Vmn2r1 .

What protocols ensure stable reconstitution of lyophilized V1rb13?

Reconstitute lyophilized protein in Tris/PBS buffer (pH 8.0) with 6% trehalose to prevent aggregation . For long-term storage, add 50% glycerol and aliquot to avoid >3 freeze-thaw cycles. Post-reconstitution, validate structural integrity via circular dichroism: expect α-helix peaks at 208 nm and 222 nm, with β-sheet signals <15% . Deviations indicate misfolding, requiring additional refolding steps with redox shuffling buffers.

How can researchers resolve discrepancies between in vitro binding assays and in vivo behavioral responses?

This paradox often stems from tissue-specific post-translational modifications absent in recombinant proteins. Implement two strategies:

  • Glycosylation Profiling: Treat HEK293-expressed V1rb13 with PNGase F and compare binding kinetics to E. coli-derived protein .

  • Co-receptor Reconstitution: Co-express V1rb13 with promiscuous Gα subunits (e.g., Gα15) in heterologous systems to amplify signaling cascades .

Table 2: Discrepancy Analysis Workflow

StepMethodExpected Outcome
1SPR with native tissue extractIdentify missing binding partners
2Phosphorylation site mappingDetect activation-state markers
3In situ hybridizationVerify endogenous expression zones

What strategies enhance V1rb13’s stability for crystallography studies?

Crystallization requires monodisperse protein at ≥5 mg/mL. Use detergent screening (e.g., n-dodecyl-β-D-maltoside) to stabilize the transmembrane domain. Mutate flexible regions (residues 150–165) via alanine scanning, guided by homology modeling against solved GPCR structures . For cryo-EM, embed V1rb13 in nanodiscs with MSP1E3D1 scaffold protein to preserve native conformation .

How does V1rb13’s signaling pathway interact with downstream neuronal circuits?

Utilize in vivo optogenetic inhibition coupled with calcium imaging in transgenic V1rb13-Cre rats. Inject AAV-DIO-hM4Di into the vomeronasal organ and monitor c-Fos expression in the medial amygdala after ligand exposure. Quantify signal transduction latency (typically 200–500 ms) using GCaMP6f reporters . Unexpected delays (>1 s) suggest intermediate kinases like PKC-δ are involved, requiring phosphoproteomic validation.

What computational models predict V1rb13’s ligand repertoire?

Combine molecular docking (AutoDock Vina) and machine learning. Train a neural network on 200 known vomeronasal ligands using molecular descriptors (LogP, polar surface area). Validate top candidates (n ≥ 20) via SPR. Critical metrics:

  • Receiver Operating Characteristic (ROC) AUC >0.85

  • Matthews Correlation Coefficient (MCC) >0.4
    False positives often derive from overfitting; address this by including decoy ligands in training sets .

Addressing Non-specific Binding in Affinity Purification

Problem: His-tag interactions with bacterial chaperones (e.g., GroEL). Solution: Incorporate 20 mM imidazole in lysis buffer and use tandem affinity tags (Strep-II + His). Validate via SDS-PAGE with Coomassie and anti-Strep Western blot .

Standardizing Functional Assays Across Laboratories

Adopt the IFRA (International Forum on Receptor Assays) guidelines:

  • Use 10 nM fluorescent IP3 analog for Gq-coupled signaling quantification

  • Normalize responses to maximum ATP-induced calcium release

  • Report Z’-factor >0.5 for high-throughput screens .

Interpreting Evolutionary Divergence in V1rb13 Orthologs

Construct phylogenetic trees using maximum likelihood (RAxML) with 100 bootstraps. Key residues under positive selection (e.g., Phe209, Asp275) are identified via CodeML. Test these via site-directed mutagenesis and ligand-binding assays. Rat-specific substitutions (Gly115Arg) may alter ligand specificity compared to mouse orthologs .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.