The Recombinant Rat Vomeronasal type-1 receptor B14 (V1rb14), designated as Vom1r96 (Uniprot ID: Q5J3L4), is a transmembrane G protein-coupled receptor (GPCR) expressed in the rat vomeronasal organ (VNO). It belongs to the V1R family, which plays a critical role in detecting pheromones and chemosensory cues. The recombinant protein is produced via E. coli expression systems with an N-terminal 10xHis-tag for purification and stability .
| Parameter | Details |
|---|---|
| Product Code | CSB-CF705451RA |
| Storage Conditions | -20°C for long-term storage; 4°C for working aliquots (up to 1 week) |
| Protein Length | Full-length (aa 1–319) |
| Expression System | In vitro E. coli |
| Shelf Life | 6 months (liquid), 12 months (lyophilized) at -20°C/-80°C |
The sequence of V1rb14 is:
MNKVNILPSDTNIKITLFSEVSVGISANSVLFFAHLCMFFEENRSKPIDLCIAFLSL TQL MLLVTMGLIAADMFMSQGIWDSTTCRSIIYFHRLLRGFNLCAACLLHILWTFTLS PRSSC LTKFKHKSPHHISCAFFSLCVLYMLFSSHLFVLIIATSNLTSDHFMYVTQSCSILP MSYS RTTMFSLVMVTREAFLISLMALFSGYMVTLLWRHKKQVQHLHSTSLSSKSSPQ QRATRTI LLLMSFFVVLYILDIVIFQSRTKFKDGSMFYSLHIIVSHSYATISPFVFIFSDKRIIKF L GSMSGRIINICLFSDGYGP .
V1Rs, including V1rb14, are hypothesized to mediate pheromone detection through interactions with sulfated or glucuronidated steroids, as demonstrated by related receptors like V1rj2 and V1rj3 . These receptors exhibit narrow dynamic ranges and high sensitivity to specific ligands, often responding to sub-nanomolar concentrations .
Unlike odorant receptors (ORs), V1Rs face difficulties in surface expression in non-native systems (e.g., HEK293 cells), requiring endogenous chaperones for proper trafficking . This limitation has restricted functional studies on V1rb14, as most research focuses on transgenic models or native VNO systems .
Studies on analogous V1Rs (e.g., V1rj2) reveal:
Ligand Specificity: Activation by sulfated estrogens (e.g., E1050, E1103) and glucuronidated steroids .
Dose-Response Dynamics: Bell-shaped curves peaking at 10⁻⁹–10⁻⁷ M, with maximal responses at 10× the first response concentration (FRC) .
Structural Requirements: Critical roles for the 17β-hydroxyl group and unsaturated A-ring in ligand binding .
While these findings are not directly applicable to V1rb14, they provide a framework for hypothesizing its potential ligand preferences.
V1rb14 is a poorly characterized member of the rat V1R family, with limited functional data in the provided sources. While its recombinant form is commercially available for research, its ligand specificity, signaling pathways, and ecological relevance remain unexplored. Further studies using transgenic models or native VNO systems are essential to elucidate its role in pheromone detection and social behavior.
UniGene: Rn.129645
Vomeronasal type-1 receptor B14 (V1rb14), also known as Vom1r96, belongs to the V1R family of vomeronasal receptors expressed in the vomeronasal organ (VNO) of rats. These receptors function as chemical detectors for pheromones and environmental signals, mediating social and reproductive behaviors in mammals. Experimental evidence has demonstrated that V1Rs function as receptors for both pheromones and environmental signals, such as those from prey and predators .
V1rb14 is part of the larger V1R receptor family, which in rats comprises approximately 108 functional receptors based on VNO-enriched expression patterns . These receptors play crucial roles in chemical communication affecting various behavioral aspects, including mate selection, territorial defense, and offspring recognition.
V1rb14 (Vom1r96) is part of the V1R family, which contains approximately 180 vomeronasal receptors in rats, including 93 V1Rs and 87 V2Rs based on comprehensive genomic analyses . These receptors are organized in clusters throughout the genome, reflecting their evolutionary history through gene duplication and diversification.
The classification of V1R genes has been refined through high-throughput microarray detection, which has confirmed that most computationally predicted V1R genes, including V1rb14, are indeed expressed specifically in the vomeronasal organ. This expression pattern confirms their role as chemosensory receptors .
While the search results don't specifically address V1rb14 developmental expression, research on vomeronasal receptors has revealed diverse temporal expression patterns throughout development. Microarray studies have categorized these patterns, suggesting different functional roles during various developmental stages .
Expression profiling of vomeronasal receptors has revealed:
Various temporal expression patterns, indicating behavior-related functions
Differential expression between receptor subtypes across developmental stages
Coordinated expression with specific transcription factors
These patterns suggest that V1rb14, like other vomeronasal receptors, may undergo developmental regulation that correlates with the acquisition of specific behaviors or physiological functions at different life stages .
Research comparing vomeronasal receptor expression between rat subspecies has shown significant variations. For example, in a study comparing the North China subspecies (R. n. humiliatus, RNH) with the Northeast China subspecies (R. n. caraco, RNC), certain vomeronasal receptors showed differential expression patterns .
While V1rb14 wasn't specifically mentioned in the subspecies comparison, similar V1R family receptors like Vom1r68 showed significantly higher expression in RNH females compared to RNC females. This pattern of subspecies-specific expression differences is likely to apply to other V1R family members, potentially including V1rb14, and may reflect adaptation to different ecological niches and pheromone communication systems .
For recombinant V1rb14 production, E. coli expression systems have proven effective. According to product specifications, recombinant Rat V1rb14 can be successfully expressed in vitro using E. coli expression systems . The protein is typically produced with an N-terminal 10xHis-tag to facilitate purification and downstream applications.
For functional studies requiring proper protein folding and post-translational modifications, mammalian expression systems like HEK293-T cells may be preferable. These systems have been successfully used for the expression of other vomeronasal receptors, ensuring proper membrane localization and function as demonstrated through immunofluorescence analyses and calcium imaging experiments .
Recombinant V1rb14 is typically provided in either liquid form or as a lyophilized powder. For optimal stability and functionality, the following storage conditions are recommended:
Store at -20°C/-80°C upon receipt
Aliquot for multiple use to avoid repeated freeze-thaw cycles
For lyophilized powder: Reconstitute in Tris/PBS-based buffer, pH 8.0, containing 6% Trehalose
The shelf life varies depending on storage conditions:
Liquid form: Approximately 6 months at -20°C/-80°C
Lyophilized form: Approximately 12 months at -20°C/-80°C
Repeated freezing and thawing should be avoided as it can significantly reduce protein activity and stability .
Calcium imaging has emerged as a powerful technique for verifying ligand-receptor interactions for vomeronasal receptors. While specific data for V1rb14 isn't provided in the search results, the methodology used for similar receptors can be applied:
Express V1rb14 in a heterologous cell system (e.g., HEK293-T cells)
Confirm membrane localization using immunofluorescence with appropriate markers
Load cells with calcium-sensitive fluorescent dyes
Apply potential ligands and monitor intracellular calcium flux in real-time
Quantify response amplitude and kinetics to determine ligand specificity
This approach has been successfully used to verify the responsiveness of Vom1r68 to 2-heptanone and Vom2r53 to MUP13 in transfected HEK293-T cells, providing a methodological framework that can be adapted for V1rb14 studies .
Identifying natural ligands for vomeronasal receptors remains challenging due to the vast number of potential compounds and the specificity of receptor-ligand interactions. Based on current research approaches, the following strategies can be employed for V1rb14 ligand identification:
Comparative expression analysis: Examining receptor expression differences between subspecies alongside variations in pheromone production can provide insights into receptor-ligand pairs. This approach successfully identified Vom1r68 as a receptor for 2-heptanone and Vom2r53 for MUP13 .
Heterologous expression and functional screening: Express V1rb14 in cell lines like HEK293-T and screen against candidate ligands using calcium imaging or other functional assays to detect activation .
High-throughput microarray analysis: Correlate receptor expression patterns with behavioral or physiological responses to specific chemical stimuli .
Computational prediction: Use bioinformatic approaches to predict potential ligands based on structural similarities with receptors of known ligand specificity.
These approaches can be combined in a targeted strategy to narrow down potential V1rb14 ligands, focusing on molecules relevant to rat social and reproductive behaviors.
While specific information about V1rb14's role is limited in the search results, research on vomeronasal receptors provides a framework for understanding its potential contributions:
V1R family receptors like V1rb14 are primarily involved in detecting volatile pheromones that mediate essential social and reproductive behaviors. These may include:
Mate recognition and selection
Territorial marking and recognition
Male-male aggression
Predator avoidance
Mother-offspring recognition
The coadaptation or genetic coupling between pheromones and their receptors suggests that V1rb14 has evolved to detect specific chemical signals relevant to rat social communication. The genetic differences in receptor expression between rat subspecies further support the idea that these receptors, potentially including V1rb14, have undergone adaptation to detect the specific pheromone profiles relevant to each subspecies' ecological niche .
Optimized probe design is crucial for reliable detection of vomeronasal receptor expression, as these genes typically exhibit low expression levels. Based on microarray studies of vomeronasal receptors, the following strategies are recommended:
Design probes targeting the 3'UTR region when possible, as this significantly increases detection sensitivity. Research has shown that probes directed at 3'UTRs have higher expression signals than those from the coding region (63% of significantly VNO-enriched probes are directed at 3'UTRs) .
Use combined predictions from multiple, unrelated programs to identify 3'UTR regions, as current prediction algorithms may lead to false negatives.
Position probes as close as possible to the polyA sites, as reverse transcription efficiency decreases with increasing distance from these sites.
When designing custom arrays, include both coding region and predicted 3'UTR probes to increase the chances of detection.
These strategies have proven effective in increasing the detection sensitivity for vomeronasal receptors in microarray studies and can be applied to V1rb14 expression analysis .
When conducting functional studies on V1rb14, several controls and validation methods should be incorporated to ensure reliable results:
Expression validation:
Functional controls:
Include cells transfected with empty vectors as negative controls
Use receptors with known ligands as positive controls
Test structurally related and unrelated compounds to confirm specificity
Cross-validation approaches:
Combine heterologous expression with in vivo approaches
Compare calcium imaging results with other functional assays
Validate findings using gene knockout or knockdown approaches
These controls and validation methods help ensure that observed responses are specifically attributable to V1rb14 activation and not to non-specific effects or experimental artifacts.
Understanding the differences between recombinant V1rb14 behavior in heterologous systems versus native neurons is crucial for interpreting experimental results:
Native VNO neurons express V1rb14 in a specific cellular context with:
Appropriate G-protein coupling mechanisms
Downstream signaling components
Proper membrane composition and organization
Co-expression of accessory proteins that may modulate receptor function
Research on other vomeronasal receptors suggests that while heterologous systems provide valuable information about ligand specificity, they may not fully recapitulate the sensitivity and specificity observed in native neurons. Comparative studies between heterologous systems and ex vivo VNO preparations can help bridge this gap and provide a more complete understanding of V1rb14 function .
Evolutionary studies of vomeronasal receptors can provide insights into species-specific adaptations in chemical communication:
The coadaptation or genetic coupling between pheromones and their receptors represents a form of coevolution that has been suggested but not thoroughly documented in mammals. Research comparing receptor expression between rat subspecies (R. n. humiliatus and R. n. caraco) has shown that differences in pheromone production correlate with differences in receptor expression, suggesting genetic coupling between signal production and detection systems .
Species-specific adaptations in receptor structure and function
Correlation between ecological niches and receptor repertoires
Evolutionary patterns of gene duplication and diversification
Potential cases of convergent or divergent evolution in chemical communication systems
These evolutionary insights could contribute to our understanding of speciation mechanisms and the role of chemical communication in reproductive isolation.
Several cutting-edge technologies hold promise for advancing our understanding of V1rb14 and other vomeronasal receptors:
CRISPR-Cas9 gene editing: Creating precise knockouts or modifications of V1rb14 in rats to study its function in vivo.
Single-cell RNA sequencing: Characterizing the expression profile of individual VNO neurons to understand receptor co-expression patterns and cell type heterogeneity.
Cryo-EM and structural biology approaches: Determining the three-dimensional structure of V1rb14 to understand ligand binding mechanisms and facilitate structure-based drug design.
Optogenetic and chemogenetic tools: Controlling the activity of V1rb14-expressing neurons to investigate their role in behavioral circuits.
Organ-on-chip technologies: Creating microfluidic systems that mimic the VNO microenvironment for more physiologically relevant functional studies.
These technologies, combined with established approaches like calcium imaging and heterologous expression systems, could significantly advance our understanding of V1rb14 function and its role in rat chemical communication .
Research on V1rb14 and other vomeronasal receptors has potential applications in various fields:
Pest management: Understanding rat pheromone detection could lead to improved attractants or repellents for rodent control.
Conservation biology: Knowledge of chemical communication can inform conservation strategies for endangered rodent species.
Biomedical research: Insights into chemical detection mechanisms may inform research on human chemosensory disorders.
Biosensor development: Vomeronasal receptors could be incorporated into biosensors for detecting specific chemicals relevant to environmental monitoring or security applications.
Comparative neurobiology: V1rb14 research contributes to our broader understanding of sensory system evolution and function across species.
These applications highlight the translational potential of basic research on vomeronasal receptors like V1rb14, demonstrating its relevance beyond fundamental science .