Recombinant Rat Vomeronasal type-1 receptor B5 (V1rb5)

Shipped with Ice Packs
In Stock

Description

Functional Insights from Research

Role in Pheromone Detection

  • V1rb5 is co-expressed with Gαi2 in VNO neurons, mediating inositol trisphosphate signaling upon ligand binding .

  • Unlike V2Rs (which detect proteinaceous ligands), V1Rs like V1rb5 are tuned to small volatile compounds .

  • Clustered genomic organization stabilizes transcription: functional V1Rs are retained in gene clusters, while isolated pseudogenes lose expression .

Ligand Specificity

  • While direct ligands for V1rb5 remain uncharacterized, related V1Rs detect sulfated steroids (e.g., corticosterone-21 sulfate) .

  • Structural analysis suggests transmembrane domains V–VII are critical for ligand discrimination .

Applications in Research

Experimental Use Cases

  • Binding Assays: Used to study receptor-ligand interactions via surface plasmon resonance (SPR) or fluorescence-based platforms .

  • Antibody Production: Serves as an immunogen for generating anti-V1rb5 antibodies (e.g., ELISA kits) .

  • Neuronal Pathway Studies: Helps map VNO signaling cascades linked to innate behaviors .

Comparative Analysis with Related Proteins

FeatureV1rb5 (Rat)Vmn1r51 (Rat)Human V1R Homologs
Gene ClusterChromosome 6 cluster Chromosome 7 cluster Pseudogenized (e.g., VN1R1)
ExpressionVNO apical neurons VNO neurons Olfactory epithelium (rare)
FunctionPheromone detection Pheromone detection Nonfunctional (pseudogenes)

Evolutionary and Species-Specific Notes

  • Rodent-Specific Expansion: Rats retain ~30–40 functional V1R genes, while humans retain only pseudogenes .

  • Transcriptional Stability: Clustered V1Rs show higher expression levels than isolated pseudogenes .

Research Challenges and Future Directions

  • Ligand Identification: High-throughput screening is needed to map V1rb5’s ligand repertoire.

  • Structural Studies: Cryo-EM could resolve its activation mechanism.

  • Behavioral Links: Knockout models may clarify its role in rat social behaviors.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
Vom1r93; V1rb5; Vomeronasal type-1 receptor 93; M21 pheromone receptor; Pheromone receptor VN4; Vomeronasal receptor 4; Vomeronasal type-1 receptor B5; mV1R3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Vom1r93
Target Protein Sequence
MNKDNTLHVDTIMKITMFSEVSVGILANSILFFAHLCMLLGENKPKPIHLYIASLSLTQL MLLITMGLIAADMFISQGIWDSTSCQSLIYLHRLSRGFTLSAACLLNVFWMITLSSKKSR LTKFKHNSPHHISGAFLLLCVLYMCFSSHLILSIIATPNLTSDNFMYVTKSCSFLPMCYS RTSMFSTTIAVREAFFIGLMALSSGYLVAFLWRHRKQAQHLHSTGLSSKASPEQRATETI LLLMSFFVVLYILENVVFYSRMKFKDGSTFYCVQIIVSHSYATVSSFVFIFTEKRMTKIL RSVCTRIINI
Uniprot No.

Target Background

Function
Putative pheromone receptor implicated in the regulation of both social and reproductive behavior.
Database Links

UniGene: Rn.10142

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in 1-4% of neurons of the vomeronasal organ. Only one pheromone receptor gene may be expressed in a particular neuron. Not expressed in the main olfactory epithelium.

Q&A

What is Vomeronasal type-1 receptor B5 and what is its biological function?

Vomeronasal type-1 receptor B5 (V1rb5), also known as Vom1r93, is a seven-transmembrane G-protein coupled receptor (GPCR) expressed in the vomeronasal organ (VNO), a specialized olfactory structure located in the nasal septum of rodents. This receptor belongs to the V1R family and plays a crucial role in pheromone detection and chemical communication between animals. V1Rs are involved in mediating various social and reproductive behaviors in rodents. Deletion of V1R gene clusters in mice has been shown to result in significant behavioral modifications, including reduced male libido and inappropriate maternal aggressive behavior .

What are the common synonyms and identifiers for rat V1rb5?

The rat Vomeronasal type-1 receptor B5 is known by several synonyms in the scientific literature:

  • Vom1r93 (primary gene name)

  • V1rb5

  • Vomeronasal type-1 receptor 93

  • M21 pheromone receptor

  • Pheromone receptor VN4

  • Vomeronasal receptor 4

  • mV1R3

The UniProt identifier for this protein is Q5J3L7 .

How should recombinant V1rb5 protein be stored and reconstituted for optimal stability?

For optimal stability, store lyophilized recombinant V1rb5 protein at -20°C to -80°C upon receipt. Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles, which can degrade the protein. Working aliquots can be stored at 4°C for up to one week.

Reconstitution protocol:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (recommended 50%)

  • Aliquot for long-term storage at -20°C/-80°C

The protein is typically provided in a Tris/PBS-based buffer with 6% trehalose at pH 8.0 .

What expression systems are most effective for producing functional recombinant V1rb5?

While E. coli is commonly used for producing recombinant V1rb5 protein for structural and biochemical studies , mammalian expression systems are preferred for functional studies due to their ability to perform proper post-translational modifications essential for GPCR function.

Recommended expression systems:

How can I design effective ligand binding assays for V1rb5?

Designing effective ligand binding assays for V1rb5 requires careful consideration of several factors:

Key parameters for successful binding assays:

  • Equilibrium time determination: Calculate the minimum incubation time required to reach equilibrium based on the dissociation rate constant (koff):

    • Use a time greater than 5 × 0.693/koff = 5 × t1/2 for the dissociation reaction

    • For receptors with slow dissociation kinetics, longer incubation times are essential (e.g., at Kd = 0.3 pM, equilibrium time can extend to ~35 hours)

  • Receptor preparation: Use membrane fractions containing the receptor that can be divided into consistent aliquots

  • Binding protocol:

    • Incubate aliquots of the receptor preparation with chosen concentrations of labeled ligand

    • Maintain defined time, temperature, and buffer conditions

    • Use rapid membrane filtration to separate bound from free ligand

    • Include controls with unlabeled competitors to determine non-specific binding

  • Types of binding experiments recommended:

    • Kinetic experiments: Measure binding at incrementing time points to estimate association (kon) and dissociation (koff) rate constants

    • Saturation experiments: Measure binding of increasing concentrations of radioligand at equilibrium to determine binding affinity (Kd) and receptor density (Bmax)

    • Competition experiments: Measure the competition between a fixed concentration of radioligand and varying concentrations of unlabeled ligands

What methods can I use to validate the functional activity of recombinant V1rb5?

Validating the functional activity of recombinant V1rb5 requires demonstrating its ability to bind ligands and activate downstream signaling pathways. The following methods are recommended:

Functional validation techniques:

  • Calcium imaging:

    • Transfect HEK293-T cells with V1rb5, appropriate G-proteins (Gαi2), and Trpc2

    • Load cells with calcium-sensitive dye (e.g., Fura-2-AM) for 40 minutes at 37°C

    • Use an ion imaging system to monitor changes in calcium levels

    • Apply potential ligands at a flow rate of 1 mL/min

    • Include 100 mM KCl in Ringer's solution as a positive control to check cell viability

    • Allow 4+ minute intervals between stimuli for cell recovery

  • Immunofluorescence:

    • Use antibodies specific to V1rb5 or to an epitope tag (e.g., His-tag)

    • Verify membrane localization of the receptor

    • Co-staining with membrane markers can confirm proper trafficking

  • Binding assays with known ligands:

    • Test binding to known or predicted pheromones (e.g., 2-heptanone, 4-heptanone)

    • Prepare stock solutions in DMSO and dilute to working concentrations (e.g., 10⁻⁵ M) in appropriate buffer

    • Include proteins like MUPs (Major Urinary Proteins) that may act as ligand carriers

How does the evolutionary profile of V1rb5 compare to other vomeronasal receptors?

V1rb5 and other vomeronasal receptors show interesting evolutionary patterns that reflect their role in species-specific chemical communication:

Evolutionary characteristics:

  • Elevated non-synonymous to synonymous substitution ratios (KA/KS):

    • V1R genes, including V1rb5, show median KA/KS values exceeding 0.11 (the median for all mouse-rat orthologs)

    • This indicates possible adaptive evolution, consistent with their role in species-specific pheromone detection

  • Positively selected sites:

    • Maximum likelihood models identified 14 positively selected sites (ω+ sites) in mouse V1R genes and their rat orthologs

    • These sites are predominantly located in extracellular loops and four of the seven transmembrane regions

    • The rapid evolution of these sites likely reflects their involvement in ligand binding interactions

    • This pattern differs from V2R receptors, where positively selected sites are concentrated in the extracellular mGluR1-homologous domain

  • Functional implications:

    • The pattern of positive selection suggests that these receptors are evolving to detect different pheromones in different species

    • This evolutionary pattern may contribute to species isolation mechanisms and reproductive barriers

What experimental approaches can reveal structure-function relationships in V1rb5?

Understanding the structure-function relationships of V1rb5 requires a multidisciplinary approach:

Recommended experimental approaches:

  • Site-directed mutagenesis:

    • Target evolutionarily conserved residues for mutation

    • Focus on the 14 positively selected sites (ω+ sites) identified in V1R genes, particularly those in extracellular loops and transmembrane domains

    • Create single amino acid substitutions and analyze effects on ligand binding and signaling

  • Chimeric receptor construction:

    • Create chimeras between V1rb5 and other V1R family members with different ligand specificities

    • Exchange extracellular loops, transmembrane domains, or intracellular regions

    • Test the resulting chimeras for altered ligand specificity or signaling properties

  • Homology modeling and molecular dynamics:

    • Generate structural models based on crystal structures of related GPCRs

    • Identify potential ligand binding pockets

    • Use molecular dynamics simulations to predict conformational changes upon ligand binding

  • Cross-species comparative analysis:

    • Compare V1rb5 sequences and function across closely related species

    • Correlate sequence differences with behavioral or functional differences

    • Identify residues that may be involved in species-specific pheromone recognition

How can differential expression of V1rb5 between rat subspecies inform experimental design?

Recent studies have identified differences in vomeronasal receptor expression between rat subspecies, which has important implications for experimental design:

Key considerations for experimental design:

  • Strain-specific expression patterns:

    • While V1rb5 (Vom1r93) itself wasn't specifically mentioned as differentially expressed, other V1r family members like Vom1r68 show significantly higher expression in RNH females compared to RNC females

    • Vom1r60 and Vom1r81 show lower expression in RNH females than in RNC females

    • Similar differences exist in the V2r family (Vom2r53 higher in RNH, Vom2r43 lower in RNH)

  • Experimental implications:

    • When studying V1rb5 or other vomeronasal receptors, researchers should:

      • Document and report the specific rat strain used

      • Consider possible strain-dependent differences in receptor expression and function

      • Include strain-matched controls in comparative studies

      • Verify receptor expression levels in their specific experimental animals

  • Methodological approaches:

    • Use qPCR to quantify receptor expression levels in different strains

    • Perform RNA-seq for comprehensive analysis of receptor expression profiles

    • Consider the impact of strain differences when interpreting behavioral responses to pheromones

What are common challenges in working with recombinant V1rb5 and how can they be addressed?

Working with membrane proteins like V1rb5 presents several technical challenges:

Common challenges and solutions:

  • Poor expression levels:

    • Problem: GPCRs often express poorly in heterologous systems

    • Solution: Add a signal peptide (e.g., RHO) to the N-terminus to enhance membrane trafficking

    • Solution: Optimize codon usage for the expression system

    • Solution: Use vectors with strong promoters appropriate for the expression system

  • Improper membrane localization:

    • Problem: Recombinant V1rb5 may not properly localize to the plasma membrane

    • Solution: Co-express with chaperones that facilitate proper folding

    • Solution: Include a fluorescent tag to monitor localization

    • Solution: Optimize cell culture conditions (temperature, time post-transfection)

  • Protein instability:

    • Problem: Membrane proteins can be unstable after purification

    • Solution: Include 6% trehalose in storage buffer

    • Solution: Add glycerol (5-50%) to reconstituted protein

    • Solution: Avoid repeated freeze-thaw cycles by preparing single-use aliquots

  • Non-functional protein:

    • Problem: Recombinant protein may lack functional activity

    • Solution: Ensure co-expression with appropriate G-proteins (Gαi2) and signaling components (Trpc2)

    • Solution: Verify protein folding and post-translational modifications

    • Solution: Test multiple expression systems if E. coli-expressed protein lacks activity

How can I optimize calcium imaging protocols for studying V1rb5 activation?

Calcium imaging is a powerful technique for studying V1rb5 function, but requires careful optimization:

Optimization strategies:

  • Cell preparation and transfection:

    • Seed HEK293-T cells onto poly-D-lysine coated slides (100 μg/ml)

    • Transfect at 40-60% confluence with:

      • 2.5 μg of pME18S-Rho-V1rb5 (including RHO signal peptide)

      • 1.5 μg of pME18S-Gαi2

      • 1.0 μg of pME18S-Trpc2

    • Use a transfection reagent ratio of 2.5 μl per μg DNA

    • Allow 24 hours for protein expression

  • Calcium indicator loading:

    • Use Fura-2-AM as the calcium indicator

    • Incubate cells with the dye for 40 minutes at 37°C

    • Wash thoroughly to remove excess dye

  • Stimulus delivery:

    • Deliver compounds at a flow rate of 1 ml/min using a peristaltic pump

    • Use stimulus durations of approximately 2 minutes

    • Allow interstimulus intervals of 4 minutes or longer for cell recovery

    • Prepare pheromone solutions as 1 M stock in DMSO, then dilute to working concentrations (e.g., 10⁻⁵ M) in Ringer's solution

    • For protein ligands (e.g., MUPs), use approximately 30 μl of purified protein in 40 ml of Ringer's solution to achieve 10⁻⁷ M concentration

  • Controls and validation:

    • Include 100 mM KCl in Ringer's solution as a positive control to verify cell viability

    • Include vehicle controls (e.g., DMSO at the same concentration used for pheromone dilution)

    • Use cells expressing known receptors with established ligands as positive controls for the assay system

What emerging technologies could advance our understanding of V1rb5 function?

Several cutting-edge technologies hold promise for deepening our understanding of V1rb5 and other vomeronasal receptors:

Emerging research approaches:

  • Cryo-electron microscopy (Cryo-EM):

    • Could reveal the detailed 3D structure of V1rb5 alone or in complex with ligands

    • Would provide insights into the structural basis of ligand recognition and binding pocket architecture

    • May identify conformational changes associated with receptor activation

  • CRISPR/Cas9 gene editing:

    • Generate precise V1rb5 knockout or knockin animal models

    • Create reporter lines with fluorescently tagged V1rb5 to track expression

    • Introduce specific mutations to test structure-function hypotheses in vivo

  • Single-cell transcriptomics:

    • Characterize the complete repertoire of vomeronasal receptors expressed in individual VNO neurons

    • Identify patterns of co-expression with other signaling components

    • Map receptor expression to specific zones or cell types within the VNO

  • Advanced imaging techniques:

    • In vivo calcium imaging in the VNO during pheromone exposure

    • Super-resolution microscopy to visualize receptor distribution and trafficking

    • Optogenetic manipulation of V1rb5-expressing neurons to correlate activation with behavior

How can high-throughput screening approaches be applied to identify V1rb5 ligands?

Identifying ligands for orphan receptors like V1rb5 remains challenging. High-throughput approaches offer promising strategies:

High-throughput screening strategies:

  • Cell-based reporter assays:

    • Develop stable cell lines expressing V1rb5 and downstream signaling components

    • Incorporate fluorescent or luminescent reporters responsive to receptor activation

    • Screen libraries of potential pheromones and metabolites

    • Use automated liquid handling and plate reading for high throughput

  • Metabolomics-guided screening:

    • Compare volatile and non-volatile compounds in urine or other secretions from animals showing behavioral differences

    • Identify compounds that differ between sexes, reproductive states, or strains

    • Test candidate compounds individually and in mixtures for receptor activation

    • Focus on compounds like 2-heptanone and 4-heptanone that have shown species differences

  • Comparative genomics approaches:

    • Correlate sequence differences in V1rb5 across species with differences in ligand preference

    • Focus screening efforts on compounds that differ in evolutionary relevant contexts

    • Use positively selected sites as a guide for understanding ligand binding pockets

  • Computational ligand prediction:

    • Use homology models and molecular docking to predict potential ligands

    • Apply machine learning algorithms trained on known GPCR-ligand interactions

    • Prioritize compounds with structural features common to known pheromones

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.