Recombinant Rat Vomeronasal type-1 receptor B6 (V1rb6)

Shipped with Ice Packs
In Stock

Description

Key Molecular Features

ParameterDetails
Uniprot IDQ5J3N1
SpeciesRattus norvegicus (rat)
TagDetermined during production (e.g., His-tag, GST, or others)
Expression Region1–308 amino acids
Storage BufferTris-based buffer with 50% glycerol
Storage Conditions-20°C or -80°C; avoid repeated freeze-thaw cycles

The amino acid sequence of V1rb6 includes conserved transmembrane domains typical of V1Rs, with regions critical for ligand binding and G protein (Gαi2) coupling .

Functional Roles in Vomeronasal Signaling

V1rb6 is part of a broader family of V1Rs that mediate the detection of small, non-volatile pheromones and social cues. Key functional aspects include:

V1R vs. V2R Receptor Families

FeatureV1Rs (e.g., V1rb6)V2Rs
LigandsSmall molecules (e.g., sulfated steroids)Peptides, proteins (e.g., ESPs, MUPs)
G ProteinGαi2Gαo
VNO LayerApical neuroepitheliumBasal neuroepithelium
ProjectionAnterior accessory olfactory bulb (AOB)Posterior AOB

V1Rs are often broadly tuned, responding to multiple cues, whereas V2Rs exhibit narrower specificity . While V1rb6 has not been directly studied, related V1Rs (e.g., V1re2, V1re6) are activated by sulfated steroids like corticosterone-21 sulfate .

Recombinant Protein Utilization

The recombinant V1rb6 protein (50 µg quantity) is primarily used in:

  1. ELISA Assays: Detecting anti-V1rb6 antibodies or ligand binding.

  2. Functional Studies: Investigating receptor-ligand interactions in heterologous systems (e.g., HEK293-T cells) .

  3. Signaling Pathway Analysis: Mapping Gαi2-mediated downstream effects, such as adenylate cyclase inhibition or calcium mobilization .

Comparative Analysis of V1R Family Members

ReceptorLigand SpecificityKey Functional Insights
V1re2Corticosterone-21 sulfateDetects physiological status cues
V1re6Sulfated steroidsOverlapping specificity with V1re2
V1rb6Hypothetical small molecules (unconfirmed)Requires further characterization

Research Challenges and Gaps

  • Limited Direct Studies: Most data on V1rb6 derive from product specifications and general V1R biology . No functional knockout studies or ligand screens have been reported for V1rb6.

  • Structural Uncertainty: The extracellular domain and ligand-binding pocket of V1rb6 remain uncharacterized, unlike well-studied V1Rs like V1re2 .

  • Species-Specificity: Rat V1rb6 may exhibit divergent ligand preferences compared to mouse V1Rs, given differences in pheromone repertoires .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order. We will accommodate your requests whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. The shelf life of lyophilized forms is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
Vom1r92; V1rb6; Vomeronasal type-1 receptor 92; M24 pheromone receptor; Vomeronasal type-1 receptor B6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-308
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Vom1r92
Target Protein Sequence
MNKDNTLHTIMKITMFSEVSVGISANSILFFAHLCMLLGENRPKPFHLYIVSLSLTQLIL LITMGLIAVDMFMSWGRWDSTPCQSLIYLHRLLRGFTLCAACLLNVFWMITLSPRSSCLS KFKHNSPHHISGAFLFLCVLYMSFSSHLLVSIIATPNLTSNIFMYVTQSCSLLPMSYSRT STFSTTIAIREAFLISLMALSSGFMVTLLWRHKKQAQHLHSTSLSSKASPERRATRTILL LMSFFVVLYILENVVFYSRMKFKDGSMFYCVQIIVSHSYATISPFVFICTEKHMTKILRS VCTRIINI
Uniprot No.

Target Background

Function
This protein is a putative pheromone receptor involved in the regulation of both social and reproductive behaviors.
Database Links

UniGene: Rn.129648

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Vomeronasal type-1 receptor B6 (V1rb6) and what is its role in rats?

Vomeronasal type-1 receptor B6 (V1rb6) is a member of the vomeronasal receptor family expressed in the vomeronasal organ (VNO) of rats. It functions as a pheromone receptor involved in chemical communication between animals. V1rb6 belongs to the V1R family, which along with V2Rs, constitutes the main receptor types in the vomeronasal system. Studies have identified 108 V1Rs and 87 V2Rs in rat VNO, indicating their importance in rat chemical communication systems . These receptors detect pheromones and other semiochemicals, triggering behavioral and physiological responses related to reproduction, territorial marking, and social behaviors.

How is V1rb6 expression regulated during development?

Research on vomeronasal receptors has revealed complex temporal expression patterns during development. Comprehensive studies using high-density oligonucleotide arrays have characterized the developmental dynamics of vomeronasal receptors, including V1rb6 . Different VR genes show distinct temporal expression profiles, suggesting specific roles at different developmental stages. For V1rb6 and other V1R genes, expression typically begins during embryonic development and continues into adulthood, though the exact timing can vary. In situ hybridization experiments have been used to evaluate cell number changes over time for selected receptor genes, providing insights into the developmental regulation of these receptors .

What methods are commonly used to detect V1rb6 expression in rat tissues?

Several complementary methods are employed to detect V1rb6 expression:

RNA-based methods:

  • RT-PCR/qPCR: This technique allows quantification of V1rb6 mRNA expression levels. Primers should be designed to span exon-exon junctions to avoid genomic DNA amplification .

  • RNA-seq: High-throughput sequencing can identify differential expression of V1rb6 between tissues or experimental conditions. This method has been used to compare expression levels between rat subspecies .

  • Custom oligonucleotide arrays: High-density arrays containing probes for all vomeronasal receptors can detect specific expression patterns. Studies have employed custom-designed arrays to confirm VR expression in vomeronasal tissue .

Protein-based methods:

  • Immunohistochemistry: Using specific antibodies against V1rb6 to visualize expression in tissue sections.

  • Western blotting: Detecting V1rb6 protein in tissue lysates.

  • ELISA: Quantifying V1rb6 protein levels using recombinant proteins as standards .

In situ methods:

  • In situ hybridization: This technique localizes V1rb6 mRNA in tissue sections, providing spatial information about expression patterns. It has been used to evaluate changes in receptor-expressing cell numbers during development .

How can recombinant V1rb6 be expressed in cellular systems?

Expression of recombinant V1rb6 in cellular systems involves several key steps:

  • Vector selection and construction: Choose an appropriate expression vector containing a strong promoter (CMV for mammalian cells) and necessary elements for protein expression. Include a tag (His, FLAG, etc.) to facilitate purification and detection.

  • Cell line selection: HEK293-T cells have been successfully used for transient expression of vomeronasal receptors . These cells provide high transfection efficiency and proper post-translational modifications.

  • Transfection optimization: Optimize transfection conditions (reagent concentration, DNA:transfection reagent ratio, incubation time) to achieve maximum expression. Lipid-based transfection reagents work well for most mammalian cells.

  • Expression verification: Confirm expression through:

    • Western blotting using tag-specific antibodies

    • Immunofluorescence to visualize receptor localization (membrane localization is crucial for functionality)

    • Flow cytometry to quantify expression levels

  • Functional testing: Verify functionality through calcium imaging, as has been done with other vomeronasal receptors . This involves loading cells with calcium-sensitive dyes and measuring fluorescence changes upon ligand application.

What are the best practices for designing functional assays for V1rb6?

When designing functional assays for V1rb6, consider these best practices:

Calcium imaging assays:

  • Use proper controls (untransfected cells, cells expressing unrelated receptors)

  • Optimize dye loading conditions (concentration, time, temperature)

  • Ensure stable baseline readings before stimulation

  • Test multiple concentrations of putative ligands

  • Include positive controls (known agonists for other receptors)

Receptor-ligand binding assays:

  • Use purified recombinant V1rb6 or membrane preparations from expressing cells

  • Label potential ligands (radioactive, fluorescent) or use label-free technologies

  • Perform saturation binding experiments to determine affinity constants

  • Conduct competition assays to assess specificity

Signaling pathway analysis:

  • Investigate G-protein coupling specificity (Gαi, Gαo, etc.)

  • Measure second messenger production (cAMP, IP3, etc.)

  • Monitor downstream signaling events (ERK phosphorylation, etc.)

  • Use pathway inhibitors to confirm signaling mechanisms

How can differential expression of V1rb6 between rat subspecies be analyzed?

Analysis of differential V1rb6 expression between rat subspecies requires a comprehensive approach:

Sample collection and preparation:

  • Obtain VNO tissue from different rat subspecies under identical conditions

  • Extract RNA using methods that preserve integrity (RNAlater, flash freezing)

  • Perform quality control (RNA integrity number ≥ 8 recommended)

Quantitative analysis methods:

  • RNA-seq: This technique has revealed differential expression of vomeronasal receptor genes between rat subspecies such as R. n. humiliatus (RNH) and R. n. caraco (RNC) . The analysis pipeline includes:

    • Library preparation and sequencing (30-50 million reads per sample)

    • Quality control and read alignment to reference genome

    • Differential expression analysis using tools like DESeq2 or edgeR

    • Validation of key findings by qPCR

  • qPCR: Design subspecies-specific primers if sequence variations exist

    • Use multiple reference genes for normalization

    • Calculate relative expression using the 2^-ΔΔCt method

    • Perform biological replicates (n ≥ 3) for statistical validity

Data interpretation:
Differential expression patterns may reflect evolutionary adaptations to different environmental conditions or mating strategies. For example, research has shown markedly higher levels of pheromones (2-heptanone and MUP13) in North China subspecies (RNH) compared to Northeast China subspecies (RNC), along with corresponding differences in receptor expression .

What bioinformatic approaches are recommended for studying V1rb6 and related receptors?

Bioinformatic analysis of V1rb6 and related receptors involves multiple computational strategies:

Sequence-based approaches:

  • BLAST/BLAT searches: These tools allow identification of V1rb6 homologs across species. TBLASTN searches using known mammalian V1Rs as queries can identify putative V1R sequences with high sensitivity .

  • Multiple sequence alignment: Programs like MUSCLE or ClustalW can align V1rb6 with other V1Rs to identify conserved domains and variable regions.

  • Phylogenetic analysis: Constructing phylogenetic trees using methods like maximum likelihood or Bayesian inference can reveal evolutionary relationships between V1rb6 and other receptors.

Structural analysis:

  • Homology modeling: Since crystal structures for most vomeronasal receptors are unavailable, homology modeling based on related GPCRs can predict V1rb6 structure.

  • Molecular docking: In silico docking of potential ligands can predict binding modes and interaction energies.

Expression data analysis:

  • Profile HMM searches: Hidden Markov Models built from known V1Rs can determine the probability that candidate sequences are true V1Rs .

  • Conceptual translation: Tools like FASTY3 can identify coding regions of candidate V1Rs by comparing them to databases of previously identified receptors .

  • Expression correlation analysis: Examining co-expression patterns between V1rb6 and other genes can provide insights into functional relationships.

How can receptor-ligand interactions be characterized for V1rb6?

Characterizing V1rb6 ligand interactions requires a multi-faceted approach:

Heterologous expression systems:

  • HEK293-T cell expression: These cells have been successfully used for transient expression of vomeronasal receptors on the membrane, as verified by immunofluorescence analysis .

  • Calcium imaging: This technique can verify the responsiveness of V1rb6 to potential ligands. Researchers have used calcium imaging to confirm that vomeronasal receptors respond to specific pheromones .

Experimental setup:

ParameterOptimal ConditionsNotes
Cell density70-80% confluencyHigher density may reduce transfection efficiency
Transfection time24-48 hoursProtein expression peaks at ~48 hours post-transfection
Calcium dyeFura-2 AM (5 μM)Allow 30-60 min loading time at 37°C
Recording bufferHBSS with 2 mM Ca²⁺Maintain pH at 7.4
Ligand application50-100 μL at 2-5× final concentrationUse computer-controlled perfusion system if available
Positive controlATP (100 μM) or ionomycin (5 μM)Verifies cell viability and dye loading

Ligand identification strategies:

  • Candidate approach: Test known pheromones and structurally related compounds

  • Unbiased screening: Screen complex biological samples (urine, secretions) or chemical libraries

  • Fractionation: Separate active biological samples using chromatography techniques

  • Mass spectrometry: Identify active components in fractions showing activity

What are common challenges in V1rb6 expression studies and how can they be addressed?

Researchers often encounter several challenges when working with V1rb6:

Low expression levels:

  • Solution: Optimize codon usage for the expression system; use stronger promoters; add enhancer elements; include chaperones or trafficking proteins in co-expression systems.

Poor membrane localization:

  • Solution: Add trafficking signals; co-express with accessory proteins like REEP or RTP families; use lower culture temperatures (30-32°C); add chemical chaperones like glycerol or DMSO.

Protein aggregation:

  • Solution: Use detergents compatible with functional studies (DDM, CHAPS); optimize solubilization conditions; purify under native conditions; consider fusion partners that enhance solubility.

Functional assay sensitivity:

  • Solution: Improve signal-to-noise ratio by increasing expression levels; use amplification steps in signaling pathways; employ more sensitive detection methods; reduce background through careful control selection.

How can subspecies-specific variations in V1rb6 function be experimentally validated?

Validating subspecies-specific variations requires a systematic approach:

Sequence comparison:

  • Sequence V1rb6 from different subspecies to identify polymorphisms

  • Map variations to functional domains using structural predictions

  • Predict functional consequences using in silico tools

Functional comparison:

  • Express V1rb6 variants from different subspecies in identical cellular backgrounds

  • Compare receptor properties:

    • Surface expression levels (flow cytometry, surface biotinylation)

    • Ligand binding affinities (dose-response curves)

    • Signaling efficacy (calcium flux, cAMP production)

    • Receptor internalization rates

Swapping experiments:

  • Create chimeric receptors between subspecies variants

  • Identify which domains are responsible for functional differences

  • Perform site-directed mutagenesis of specific residues

Research has demonstrated that vomeronasal sensory neurons were more sensitive to pheromones like 2-heptanone and MUP13 in RNH compared to RNC rats, suggesting subspecies differences in receptor function that could be explored for V1rb6 .

What controls and validation steps are essential for V1rb6 research?

Rigorous controls and validation steps are critical for reliable V1rb6 research:

Expression validation controls:

  • Positive controls: Include well-characterized receptors with known expression patterns

  • Negative controls: Examine tissues known not to express V1rb6

  • Technical controls: Use multiple detection methods (qPCR, immunostaining, Western blot)

Functional assay controls:

  • Mock-transfected cells: Control for non-specific effects of transfection

  • Empty vector controls: Control for vector-driven effects

  • Unrelated receptor controls: Express receptors from different families

  • Dose-response curves: Test wide concentration ranges of ligands

  • Antagonist controls: Confirm specificity with competitive antagonists if available

Data analysis validation:

  • Biological replicates: Minimum n=3, from independent experiments

  • Technical replicates: Multiple measurements within each biological replicate

  • Statistical analysis: Apply appropriate tests (t-test, ANOVA, etc.) with corrections for multiple comparisons

  • Cross-validation: Confirm key findings using alternative methodologies

Bioinformatic validation:

  • Multiple alignment algorithms: Compare results from different tools

  • Database cross-reference: Check consistency across genomic databases

  • Conservation analysis: Examine evolutionary conservation patterns

How might single-cell technologies advance our understanding of V1rb6 function?

Single-cell technologies offer unprecedented opportunities to study V1rb6 in its native context:

Single-cell RNA sequencing (scRNA-seq):

  • Map the complete transcriptional profile of V1rb6-expressing cells

  • Identify co-expressed genes that might function in the same signaling pathway

  • Discover novel cell subtypes within the vomeronasal organ

  • Track developmental trajectories of receptor-expressing cells

Single-cell proteomics:

  • Profile the protein composition of individual V1rb6-expressing cells

  • Identify post-translational modifications affecting receptor function

  • Quantify protein-protein interactions in native cellular contexts

Spatial transcriptomics:

  • Map the precise spatial distribution of V1rb6-expressing cells in the VNO

  • Correlate expression patterns with anatomical organization

  • Identify potential topographical organization of receptor expression

What are the implications of V1rb6 research for understanding pheromone detection across species?

V1rb6 research provides valuable insights into evolutionary aspects of chemosensation:

Comparative genomics:
Research on vomeronasal receptors across species has revealed significant evolutionary dynamics. The comprehensive data mining of V1R and V2R repertoires in mouse and rat genomes demonstrated species-specific expansions and contractions of receptor families . Understanding how V1rb6 varies across species can illuminate evolutionary adaptation processes.

Functional conservation and divergence:
Studies comparing pheromone detection between rodent subspecies have shown co-adaptation between pheromones and their receptors . This suggests that V1rb6 and other receptors may undergo selection pressure to maintain detection of species-specific signals. The marked differences in receptor expression levels between subspecies like RNH and RNC further support this hypothesis.

Translational applications:
Insights from V1rb6 research may inform broader understanding of:

  • Chemical communication in mammals

  • Evolution of sensory systems

  • Mechanisms of reproductive isolation

  • Development of species-specific attractants or repellents

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.