Recombinant Rat XK-related protein 6 (Xkr6)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant Rat Xkr6 is synthesized using multiple expression systems, as detailed below:

Table 1: Production Systems for Recombinant Rat Xkr6

Host SystemPurityNotesSource
E. coli≥85%Cost-effective, suitable for bulk production
Yeast/Baculovirus≥85%Post-translational modifications
Mammalian Cells≥85%Native folding and membrane integration
Cell-Free Expression≥85%Rapid production, minimal contaminants

Functional Roles in Apoptosis

Xkr6 is implicated in the following processes:

  • PtdSer Exposure: Facilitates translocation of phosphatidylserine to the outer leaflet of the plasma membrane during apoptosis, enabling recognition by phagocytes .

  • Engulfment Signaling: Partners with scramblases and lipid transporters to coordinate apoptotic cell clearance .

Comparative Insights:

  • Caspase Dependency: Related family members (e.g., Xkr4, Xkr8, Xkr9) require caspase 3/7 cleavage for activation, suggesting Xkr6 may share this regulatory feature .

  • Tissue Specificity: Unlike ubiquitously expressed Xkr8, Xkr6 shows restricted expression patterns, potentially linking it to tissue-specific apoptotic pathways .

Gene-Chemical Interactions

Rat Xkr6 expression is modulated by diverse chemical exposures, as identified in toxicogenomic studies:

Table 2: Selected Chemical Interactions with Rat Xkr6

ChemicalEffect on Xkr6Biological ContextSource
Bisphenol ADecreases expressionEndocrine disruption studies
Cadmium ChlorideAlters methylation/expressionHeavy metal toxicity models
Sodium ArseniteDownregulates mRNAOxidative stress response
Valproic AcidAffects splicing/expressionNeurodevelopmental studies

Research Applications and Disease Associations

  • Apoptosis Studies: Used to investigate PtdSer dynamics in neurodegenerative diseases and cancer .

  • Disease Links: Associated with Keratolytic Winter Erythema and Familial Meningioma in human homolog studies .

  • Toxicology: Serves as a biomarker for chemical exposure effects on apoptotic pathways .

Ongoing Research Gaps

  • Mechanistic Details: The exact caspase cleavage sites and binding partners of Rat Xkr6 remain uncharacterized.

  • In Vivo Validation: Most data derive from in vitro models; physiological relevance in intact organisms requires further study .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Please note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein with deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference for your specific needs.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
We will select the tag type during production. If you have a specific tag type requirement, please inform us. We will prioritize the development of your specified tag.
Synonyms
Xkr6; Xrg6; XK-related protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-638
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Xkr6
Target Protein Sequence
MAAKSDGGGVGVGFAQLHNLDEAVGSGEEDGEPGGGGCGGGDGSEPGESSSLHICHCCNT SSCYWGCRSACLRSLLGKKPRRSAAAADGGDQPLQPPGAAGRHPPTPSAGRPQPASPQVE RPWLDCLWIVLALLVFFGDVGTDLWLALDYYRKGDYGCFGLTLFFVLVPSLLVQSLSFRW FVQDYTGGGLGAVEGLSSRGPPMMGAGYGHGAARGGPGAGGSATPGAQRLCRLSVWIWQS VIHLLQMGQVWRYIRTMYLGIQSQRQKEHQRRFYWAMMYEYADVNMLRLLETFLESAPQL VLQLCIMIQKNSAETLPCVSSVTSLMSLAWVLASYHKLLRDSRDDKKSMSYRGALIHLFW RLFTISSRVISFALFASIFQLYFGIFVVVHWCAMAFWIIHGGTDFCMSKWEEILFNMVVG IVYIFCWFNVKEGRTRYRMFAYYTIVLTENAALTFLWYFYRNPESTDSYAVPALCCVFVS FVAGITLMLLYYGVLHPMGPRAKVFASSCCAELLWGIPLPPDVEPMAPQTPGYRGTQVTP TRAVTEQQEDLTADTCLPVFQVRPMGPSTPSGRPYHPEGPLIKIDMPRKRYPAWDAHFVD RRLRRTINILQYVTPTAVGIRYRDGPLLYELLQYESSL
Uniprot No.

Target Background

Database Links
Protein Families
XK family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Rat XK-related protein 6 (Xkr6) and what are its key characteristics?

Rat XK-related protein 6 (Xkr6) is a multi-pass membrane protein that likely functions as a component of the XK/Kell complex of the Kell blood group system. The protein is encoded by the Xkr6 gene (also known as XRG6 or RGD1310719) in rats . Xkr6 belongs to the XK-related gene family, which are homologs of XK, a 444 amino acid protein that spans the membrane 10 times and carries the ubiquitous antigen, Kx, which determines blood type .

Rat Xkr6 is available in recombinant form with either Cell Free Expression systems or produced in E. Coli, Yeast, Baculovirus, or Mammalian Cell expression systems, typically achieving ≥85% purity as determined by SDS-PAGE . The protein exists in multiple forms, including full-length and partial versions, suggesting potential functional diversity .

How does Rat Xkr6 compare to its homologs in other species?

Xkr6 has been identified across multiple species with varying degrees of conservation:

SpeciesGene NameAliasesExpression SystemsNotes
RatXkr6XRG6, RGD1310719Cell Free, E. Coli, Yeast, Baculovirus, MammalianAvailable in full-length and partial forms
MouseXkr6Xrg6, BC024502, 2700008G24RikCell Free, E. Coli, Yeast, Baculovirus, MammalianAlso known as "X-linked Kx blood group related 6"
Tetraodon nigroviridisxkr6xrg6Cell Free, E. Coli, Yeast, Baculovirus, MammalianFish model organism
HumanXKR6Transmembrane protein C8orf5VariousMaps to chromosome 8, has been associated with personality traits in GWA studies

The conservation of Xkr6 across species suggests important biological functions, while species-specific variations may reflect evolutionary adaptations to different physiological requirements .

What are the optimal experimental controls when studying Rat Xkr6?

When designing experiments involving Recombinant Rat Xkr6, researchers should implement multiple control strategies:

Protein-Level Controls:

  • Negative control: Use an unrelated protein of similar size and structure produced in the same expression system

  • Positive control: Include a well-characterized protein known to interact with the Kell blood group complex

  • Reference standard: Incorporate a standardized batch of Rat Xkr6 with established activity measurements

Experimental Design Controls:

  • Technical replicates: Minimum of three replicates to account for procedural variability

  • Biological replicates: Use samples from multiple animals to capture biological variance

  • Vehicle controls: Include appropriate buffer-only conditions

As one researcher noted in a published protocol: "IgG control for determining specificity i.e., those proteins that are bound specifically to AR protein complex" represents a similar approach that could be adapted for Xkr6 studies .

How should researchers determine the appropriate sample size for Xkr6 functional studies?

Determining optimal sample size for Xkr6 studies requires consideration of multiple factors:

Power Analysis Considerations:

  • Effect size estimation: Based on preliminary data or similar protein studies

  • Variability assessment: Higher between-sample variability requires larger sample sizes

  • Type of experimental design: Paired designs generally require fewer samples than unpaired designs

A power simulation approach is recommended: assuming an effect size of 0.2 and standard deviation of 0.25, a minimum of 15 samples per group would be appropriate for detecting differences in Xkr6 function or expression with adequate statistical power .

What chemical interactions significantly affect Rat Xkr6 expression and how should these be controlled in experiments?

Rat Xkr6 expression is modulated by numerous chemical compounds, which must be considered when designing experiments:

ChemicalEffect on Xkr6Evidence QualityReference
17beta-estradiolDecreased expression (when co-treated with TGFB1)ISO
4,4'-sulfonyldiphenol (bisphenol S)Decreased methylationISO
6-propyl-2-thiouracilDecreased expressionEXP
AcrylamideDecreased expressionEXP
Aflatoxin B1Increased methylationISO
AmitroleDecreased expressionEXP
Antirheumatic drugsIncreased expressionISO
BelinostatIncreased expressionISO
Benzo[a]pyreneIncreased methylation, Variable expressionISO
Bisphenol ADecreased expressionEXP/ISO
Copper (deficiency)Increased expressionEXP

Methodological Recommendations:

  • Document exposure to these compounds in experimental protocols

  • Standardize culture media composition and minimize exposure to plasticware containing bisphenols

  • When studying Xkr6 expression, include assessment of exposure to these compounds as potential confounding variables

  • For in vivo studies, control for dietary factors that might affect copper levels

What are the optimal methods for validating Xkr6 protein function in experimental systems?

Validation of Xkr6 protein function requires a multi-faceted approach:

Functional Validation Strategies:

  • Genetic approaches:

    • CRISPR-Cas9 knockout/knockin models

    • siRNA knockdown with rescue experiments using recombinant protein

  • Protein interaction studies:

    • Co-immunoprecipitation with known binding partners from the Kell blood group complex

    • Proximity ligation assays to confirm interaction in intact cells

  • Physiological readouts:

    • Membrane integrity assessments

    • Blood group antigen expression analysis

As with other membrane proteins, validation should include both in vitro and in vivo approaches, with ChIP-qPCR on top hits representing a gold standard for binding interaction validation .

How should researchers address heterogeneity in Xkr6 functional studies during meta-analysis?

Addressing heterogeneity in Xkr6 studies requires rigorous meta-analytical approaches:

Recommended Heterogeneity Assessment Protocol:

  • Quantify heterogeneity using Cochran's Q statistic and I² values

  • For values of p<0.05 for Cochran's Q, investigate potential sources of heterogeneity

  • Examine study-level characteristics that might explain heterogeneity:

    • Different expression systems used for recombinant Xkr6 production

    • Variations in experimental protocols

    • Species differences if comparing across homologs

Analytical Methods for Heterogeneous Data:

  • Random effects models when heterogeneity is significant

  • Subgroup analyses based on experimental conditions

  • Meta-regression to identify factors associated with varying effect sizes

It's important to note that "in the presence of considerable heterogeneity, if random effects calculations are used, no meta-analysis, no matter how large would have enough power to detect an association at genome-wide significance" . Therefore, researchers should clearly document sources of heterogeneity rather than attempting to force consensus where true biological variation exists.

What are the best practices for designing experiments to study Xkr6 genetic associations?

When investigating Xkr6 genetic associations, researchers should consider:

Study Design Recommendations:

  • Population stratification: Account for and adjust for population stratification both at the individual study level and after combining studies

  • Direct genotyping vs. imputation: Clearly distinguish between directly-typed and imputed variants

  • Quality control measures: Implement rigorous quality control for genotyping data

  • Strand and build consistency: Ensure all data refers to the same genome build and accounts for strand differences

Statistical Approach:

  • For preliminary studies: Focus on variants with odds ratios ≥2.0 to minimize false positives from cryptic population stratification

  • For replication studies: Use larger sample sizes to detect associations with smaller effect sizes (OR<1.5)

Past genome-wide association studies have identified SNP rs6981523 in the XKR6 (intergenic) region with significant associations to personality traits (p=4.25×10⁻¹²), demonstrating the value of large-scale genomic approaches for identifying Xkr6 functional variations .

How do epigenetic modifications affect Xkr6 expression and function?

Evidence indicates that Xkr6 is subject to complex epigenetic regulation:

Key Epigenetic Mechanisms Affecting Xkr6:

  • DNA methylation: Multiple chemicals modulate Xkr6 methylation status:

    • Aflatoxin B1 increases methylation of the Xkr6 gene and intron

    • Bisphenol S decreases methylation of the Xkr6 gene

    • Benzo[a]pyrene affects methylation patterns of Xkr6 introns

  • Research methodology recommendations:

    • Include DNA methylation analysis in Xkr6 expression studies

    • Control for environmental exposures known to affect Xkr6 methylation

    • Consider chromatin immunoprecipitation sequencing (ChIP-seq) to identify transcription factor binding sites affected by methylation changes

For comprehensive epigenetic profiling, researchers should consider implementing a study design similar to ChIP-seq protocols that include "at least four mice from each group" as biological replicates to account for individual variation in epigenetic patterns .

What are the current challenges in replicating Xkr6 functional findings across different experimental systems?

Replication challenges in Xkr6 research stem from several sources:

Identified Replication Barriers:

  • Expression system variations: The recombinant Rat Xkr6 protein characteristics may differ substantially depending on whether it's produced in E. Coli, Yeast, Baculovirus, Mammalian cell systems, or Cell-Free Expression systems

  • Protein purity considerations: Even with standardized purity levels (≥85% by SDS-PAGE), the remaining 15% may contain impurities that affect functional outcomes

  • Isoform variability: The existence of both full-length and partial versions of Xkr6 introduces complexity in interpreting results across studies that may use different isoforms

Recommended Standardization Approaches:

  • Detailed reporting of expression systems and purification methods

  • Benchmarking of protein activity against standardized assays

  • Cross-validation using multiple antibodies and detection systems

  • Implementation of the "block what you can, randomize what you cannot" principle to control for technical variables

What are the most promising research questions regarding Rat Xkr6 function that remain unanswered?

Several high-priority research questions deserve investigation:

  • Membrane topology and structural biology:

    • How does the three-dimensional structure of Xkr6 facilitate its integration into the XK/Kell complex?

    • What structural features distinguish Rat Xkr6 from its homologs in other species?

  • Signaling pathway integration:

    • Does Xkr6 participate in signal transduction pathways beyond its structural role in membrane complexes?

    • How do the numerous chemical interactions with Xkr6 affect downstream cellular processes?

  • Physiological significance:

    • What are the phenotypic consequences of Xkr6 dysregulation in rat models?

    • How do genetic variations in Xkr6 contribute to phenotypic diversity and disease susceptibility?

Each of these questions requires rigorous experimental design with appropriate controls, statistical power, and validation approaches as outlined in previous sections.

How can new technological advances be applied to enhance Xkr6 research?

Emerging technologies offer new opportunities for Xkr6 research:

Promising Technological Applications:

  • CRISPR-based techniques:

    • Base editing for introducing precise mutations in Xkr6

    • CRISPRi/CRISPRa for modulating Xkr6 expression without genetic modification

  • Single-cell technologies:

    • Single-cell RNA-seq to characterize cell-specific Xkr6 expression patterns

    • Single-cell proteomics to identify cell-to-cell variability in Xkr6 protein levels

  • Advanced imaging techniques:

    • Super-resolution microscopy to visualize Xkr6 organization in membrane complexes

    • Live-cell imaging with tagged Xkr6 to track dynamic interactions

  • AI-assisted data analysis:

    • Machine learning approaches to identify patterns in Xkr6 genetic associations

    • Predictive modeling of Xkr6 structure-function relationships

When implementing these technologies, researchers should maintain focus on rigorous experimental design, including appropriate controls and statistical power calculations as described in section 2 .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.