Recombinant Rat Zinc transporter 1 (Slc30a1)
Shipped with Ice Packs 
In Stock 
Description
Detection and Quantification Methods
The Rat SLC30A1 ELISA Kit (Assay Genie, SKU: RTEB0656) is the primary tool for detecting recombinant and endogenous SLC30A1. Key specifications include:
| Parameter | Value |
|---|---|
| Detection Method | Sandwich ELISA |
| Sample Types | Serum, plasma, tissue homogenates |
| Detection Range | 78–5000 pg/mL |
| Sensitivity | 40.9 pg/mL |
| Intra-Assay CV | 6.0% |
| Inter-Assay CV | 10.6% |
| Reactivity | Rat-specific |
This kit enables precise measurement of SLC30A1 levels in diverse biological samples, critical for studying zinc dysregulation in disease models .
Functional Roles in Biological Systems
Zinc Homeostasis
-
Exports cytoplasmic zinc to extracellular space, protecting cells from zinc toxicity
-
Modulates zinc permeation through L-type calcium channels, indirectly regulating calcium influx
Disease Associations
-
Prostate Cancer: Upregulated in early-stage tumors in European-American populations, suggesting race-specific zinc dysregulation
-
Infectious Immunity:
Research Applications and Findings
Key Studies Using Recombinant SLC30A1
-
Infectious Disease Models
-
Zinc Transport Mechanisms
-
Therapeutic Insights
Comparative Analysis Across Tissues
Technical Considerations for Research
-
Antibody Specificity: Commercial kits show no cross-reactivity with other SLC30 family members
-
Zinc Modulation: Extracellular ZnSO₄ (40 μM) upregulates SLC30A1 expression by 3-fold in reporter mice
-
Compensatory Mechanisms: Metallothionein-1 (MT1) expression increases in SLC30A1-deficient systems to buffer excess zinc
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Note: While we prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for customers.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Slc30a1; Znt1; Zinc transporter 1; ZnT-1; Solute carrier family 30 member 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
329-507
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
YTTYPLLKESALILLQTVPKQIDIKHLVKELRDVEGVEEVHELHVWQLAGSRIIATAHIK CEDPASYMQVAKTIKDVFHNHGIHATTIQPEFASVGSKSSVVPCELACRTQCALKQCCGT RPQVHSGKEAEKAPTVSISCLELSENLEKKPRRTKAEGSVPAVVIEIKNVPNKQPESSL
Uniprot No.
Target Background
Function
Potentially involved in cellular zinc efflux.
Gene References Into Functions
References supporting the function of Zinc transporter 1 (ZnT-1):
- Hypoxia/reoxygenation significantly reduced ZnT-1 expression in rat astrocytes. PMID: 26463958
- Maternal zinc deficiency increased fetal heart malformations, correlating with reduced placental MT-1 and ZnT-1 mRNA expression. PMID: 24807795
- ZnT-1 interacts with GluN2A-containing NMDA receptors at glutamatergic synapses, regulated by synaptic plasticity. ZnT-1 modulation in hippocampal neurons decreased dendritic spines and GluN2A surface levels. PMID: 25319628
- Spinal cord injury significantly increased ZnT-1 and BDNF mRNA levels. PMID: 20838921
- ZnT-1 expression is crucial for maintaining zinc homeostasis, particularly for enhanced zinc retention in transformed cells under zinc deprivation. PMID: 21775119
- ZnT-1, ZnT-3, and PRG-1 are implicated in the long-term adverse effects of recurrent neonatal seizures, including hippocampal mossy fiber sprouting and cognitive deficits. PMID: 20167268
- Rapid electrical pacing increases ZnT-1 expression in vitro and in vivo rat atria. PMID: 20201890
- Increased ZnT-1 expression following zinc priming or heterologous expression reduces zinc accumulation and sensitivity to toxic zinc levels. PMID: 15378655
- ZnT-1 modulates cation permeation through L-type calcium channels (LTCC), regulating cation homeostasis. PMID: 15451416
- Zinc deficiency alters Zn transporter expression, increasing brain zinc uptake and conserving brain zinc. PMID: 15867272
- Endogenous ZnT-1, by modulating LTCC, regulates calcium influx and attenuates Cd(2+) and Zn(2+) permeation and toxicity. PMID: 16741752
- Crosstalk between ZnT-1 and LTCC may underlie atrial responses to rapid pacing, suggesting ZnT-1's role in rate-dependent cardiac electrical remodeling. PMID: 17196651
- ZnT-1, ZnT-3, CaMK II, and PRG-1 expression in the hippocampus after neonatal seizure-induced cognitive deficits in rats. PMID: 19059322
- ZnT1 directly participates in Zn(2+) efflux in cultured cortical neurons. PMID: 19095042
- Zinc transporter 1 (ZnT1) acts as an endogenous inhibitor of L-type calcium channels. PMID: 19767393
Database Links
Protein Families
Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family, SLC30A subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Note=Localized on the basolateral surface of the enterocytes.
Tissue Specificity
Widely expressed. The protein is detected in duodenum and jejunum but not in ileum and colon.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
