Recombinant Rat Zinc transporter 2 (Slc30a2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery times may vary depending on the purchase method and location. Please contact your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial before opening to collect the contents at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type is determined during the production process. If you have a preferred tag type, please communicate your requirements, and we will prioritize its development.
Synonyms
Slc30a2; Znt2; Zinc transporter 2; ZnT-2; Solute carrier family 30 member 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-359
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Slc30a2
Target Protein Sequence
MASRSFFGALWKSEASRIPPVNLPSVELAVQSNHYCHAQKDSGSHPNSEKQRARRKLYVA SAICLVFMIGEIIGGYLAQSLAIMTDAAHLLTDFASMLISLFSLWVSSRPATKTMNFGWQ RAEILGALLSVLSIWVVTGVLVYLAVQRLISGDYEIKGDTMLITSGCAVAVNIIMGLALH QSGHGHSHGHSHEDSSQQQQNPSVRAAFIHVVGDLLQSVGVLVAAYIIYFKPEYKYVDPI CTFLFSILVLGTTLTILRDVILVLMEGTPKGVDFTTVKNLLLSVDGVEALHSLHIWALTV AQPVLSVHIAIAQNVDAQAVLKVARDRLQGKFNFHTMTIQIESYSEDMKSCQECQGPSE
Uniprot No.

Target Background

Function
ZnT2 is involved in the accumulation of zinc in endosomal/lysosomal vesicles.
Gene References Into Functions
  1. In aged rats (21 months), the expression of the zinc transporter in ventral prostate (VP) was approximately 21-fold higher compared to young rats (4 months). Conversely, zinc levels in the VP of young rats exhibited a significant increase compared to aged rats. PMID: 20798384
  2. The findings suggest that ZnT2 may play a crucial role in maintaining zinc homeostasis within the prostate. PMID: 19760107
  3. Castration had no impact on the expression of zinc transporter-2 in the lateral and dorsal prostate. This indicates that factors other than zinc transporters are involved in regulating zinc homeostasis and contribute to the reduction in zinc content following castration in the rat prostate. PMID: 12399528
  4. There were no differences in the mRNA expression levels of ZnT family members between undifferentiated and differentiated Rcho-1 cells. PMID: 15475177
  5. The upregulation of ZnT1, ZnT2, and ZnT4 was observed to decrease cytosolic zinc levels induced by NO following transient occlusion of the common carotid artery. PMID: 18289514
  6. Transfection and mutation studies revealed that translation initiates at a non-AUG (CUG) start codon. PMID: 8617223

Show More

Hide All

Database Links
Protein Families
Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family, SLC30A subfamily
Subcellular Location
Endosome membrane; Multi-pass membrane protein.
Tissue Specificity
Intestine, kidney, seminal vesicles and testis.

Q&A

What is the basic structure of rat SLC30A2 protein?

Rat SLC30A2 (also known as ZnT2) is a member of the SLC30 family of zinc transporters. The protein structure consists of six transmembrane domains with cytoplasmic N- and C-termini that contain multiple regulatory domains. SLC30A2 functions as either a homo- or heterodimer in cellular environments . The protein plays a critical role in zinc transport across cellular membranes, particularly in specialized secretory cells. Understanding this structure is essential for designing expression constructs for recombinant protein production and developing structure-function studies.

What are the primary physiological functions of SLC30A2 in rats?

SLC30A2 primarily promotes the influx of zinc ions into synaptic vesicles of glutamatergic neurons from the cytoplasm, intracellular organelles, or to the outside of the cell. It is responsible for maintaining high intravesicular zinc content. Additionally, SLC30A2 imports zinc into mitochondria, which can affect ATP generation and potentially activate apoptosis pathways . In rats, expression of SLC30A2 is restricted to secretory cells, including acinar pancreatic cells, prostate epithelial cells, placental trophoblasts, and mammary epithelial cells . This specialized expression pattern indicates its tissue-specific roles in zinc homeostasis.

How does rat SLC30A2 compare structurally and functionally to human SLC30A2?

While the fundamental structure of six transmembrane domains is conserved between rat and human SLC30A2, there are notable species-specific differences. For example, antibodies designed against rat SLC30A2 epitopes may not recognize the human variant due to sequence divergence . Functionally, both rat and human SLC30A2 regulate zinc transport, but mutations in the human SLC30A2 gene have been identified that lead to pathologically low breast milk zinc concentrations, causing transient neonatal zinc deficiency in breastfed infants . Research comparing these orthologs can provide valuable insights into evolutionary conservation of zinc transport mechanisms and species-specific adaptations.

What are the optimal expression systems for producing recombinant rat SLC30A2?

Based on available research data, recombinant rat SLC30A2 can be expressed in several systems including mammalian cells (particularly HEK293), insect cells, and E. coli . Each expression system offers distinct advantages:

Expression SystemAdvantagesLimitationsApplications
E. coliHigh yield, cost-effective, rapid productionLimited post-translational modificationsStructural studies, antibody production
Mammalian cells (HEK293)Native-like post-translational modifications, proper foldingLower yield, higher costFunctional studies, protein-protein interactions
Insect cellsHigher yield than mammalian cells, some post-translational modificationsModerate costStructural and functional studies

For functional studies requiring proper protein folding and post-translational modifications, mammalian expression systems are generally preferred. When designing expression constructs, incorporating fusion tags such as His, Flag, MBP, Avi, or Fc can facilitate purification and detection of the recombinant protein .

What methods are available for detecting and quantifying rat SLC30A2 expression?

Several methodological approaches can be employed to detect and quantify rat SLC30A2:

  • Western Blot Analysis: Specific antibodies such as Anti-ZnT2 (SLC30A2) Antibody (#AZT-012) can be used at a 1:200 dilution for detecting SLC30A2 in rat tissues including small intestine . The specificity can be confirmed using blocking peptides.

  • Immunohistochemistry: For tissue localization studies, antibodies raised against specific epitopes of rat SLC30A2 can be generated following established immunization protocols. Rabbits can be immunized with 100–150 μg of purified zinc transporter protein emulsified with Freund's adjuvant, followed by booster doses at specific intervals .

  • mRNA Quantification: SLC30A2 expression can be analyzed at the transcript level using RT-PCR or RNA-Seq approaches, with specific primers designed based on the rat SLC30A2 sequence.

  • Epitope Tagging: When working with recombinant SLC30A2, incorporating epitope tags (His, Flag, etc.) enables detection using commercially available tag-specific antibodies .

How can zinc transport activity of recombinant rat SLC30A2 be measured?

Several methodological approaches can be employed to measure the zinc transport activity of recombinant rat SLC30A2:

  • Non-radioactive Stable Isotope Assays: A sensitive method employs stable zinc isotopes (such as 70Zn) instead of radioactive 65Zn. This approach involves preparing biological medium selectively depleted of natural abundance Zn(II) using A12-resin and then restoring it to physiological levels with a non-natural Zn(II) isotope distribution (comprising 70% 70Zn). Zinc uptake can then be quantified using inductively coupled plasma-mass spectrometry (ICP-MS) . This method offers excellent sensitivity without the safety concerns associated with radioactive materials.

  • Radioactive 65Zn Uptake Assays: While radioactive methods require special facilities and permissions, they provide high sensitivity. Cells expressing recombinant SLC30A2 can be incubated with uptake buffer containing 65Zn at 37°C for defined periods. After washing with stop buffer containing EDTA, cell-associated 65Zn radioactivity can be measured with a gamma counter .

  • Atomic Absorption Spectrophotometry: Total zinc accumulation in cells expressing SLC30A2 can be measured using atomic absorption spectrophotometry. Cells are processed by wet ashing method with perchloric-nitric acid mixture, and zinc content is estimated using a hollow cathode lamp at a wavelength of 213.86 nm, with values normalized to protein content .

What strategies can be used to study the subcellular localization of recombinant rat SLC30A2?

Understanding the subcellular localization of SLC30A2 is crucial for interpreting its physiological function. Several approaches can be employed:

  • Confocal Microscopy with Fluorescent Tags: Fusion of fluorescent proteins (GFP, mCherry) to SLC30A2 allows live-cell imaging. This approach is particularly useful for studying dynamic trafficking of the transporter between cellular compartments.

  • Subcellular Fractionation and Western Blotting: Cell homogenates can be separated into different organelle fractions (plasma membrane, endosomes, mitochondria, etc.) through density gradient centrifugation, followed by Western blot analysis using SLC30A2-specific antibodies .

  • Immunoelectron Microscopy: For high-resolution localization studies, immunogold labeling with SLC30A2 antibodies can be used to precisely determine its distribution within cellular ultrastructures.

  • Co-localization Studies: Using markers for specific organelles (mitochondria, synaptic vesicles, endosomes) in combination with SLC30A2 detection can help define its precise subcellular distribution patterns.

How can mutagenesis approaches be used to study structure-function relationships in rat SLC30A2?

Site-directed mutagenesis represents a powerful approach for investigating structure-function relationships in rat SLC30A2. Based on comparative studies with other zinc transporters, several strategies can be implemented:

  • Transmembrane Domain Mutations: The six transmembrane domains of SLC30A2 are critical for forming the zinc transport channel. Systematic mutation of conserved residues within these domains can identify amino acids essential for transport activity . For example, mutations in the transmembrane domains of the related zinc transporter Zip4 are associated with functional defects in humans with Acrodermatitis enteropathica .

  • Regulatory Domain Modifications: The cytoplasmic N- and C-termini of SLC30A2 contain regulatory domains that likely modulate transport activity. Truncation or specific point mutations in these regions can reveal mechanisms of transporter regulation.

  • Histidine Residue Mutations: Multiple histidine residues in loop regions between transmembrane domains may serve as zinc binding sites. Based on studies of related transporters, histidine stretches (such as HSDHSH) between transmembrane domains VI and VII may be particularly important for function, though this motif differs from other zinc transporters . Mutating these histidine residues to alanine can test their role in zinc coordination and transport.

  • Dimerization Interface Mutations: Since SLC30A2 functions as a homo- or heterodimer, identifying and mutating residues at the dimerization interface can elucidate the functional significance of oligomerization.

A systematic mutagenesis approach combined with functional assays can map critical regions and residues responsible for zinc selectivity, transport kinetics, and regulatory mechanisms.

What are effective strategies for studying protein-protein interactions involving rat SLC30A2?

Understanding the interactome of SLC30A2 is crucial for elucidating its regulatory mechanisms and physiological functions. Several complementary approaches can be employed:

  • Co-immunoprecipitation (Co-IP): Using antibodies against SLC30A2 or epitope tags in recombinant constructs, protein complexes can be isolated and interacting partners identified by mass spectrometry. This approach is particularly useful for detecting stable interactions.

  • Proximity-dependent Biotin Identification (BioID): Fusion of a biotin ligase to SLC30A2 allows biotinylation of proteins in close proximity, which can then be isolated and identified, revealing both stable and transient interactions within the cellular environment.

  • Mammalian Two-Hybrid System: This approach can detect direct protein-protein interactions by measuring reporter gene activation when two proteins of interest interact. It's particularly useful for mapping specific interaction domains.

  • Förster Resonance Energy Transfer (FRET): By tagging SLC30A2 and potential interaction partners with appropriate fluorophores, FRET can detect interactions in living cells with high spatial and temporal resolution.

  • Crosslinking Mass Spectrometry: Chemical crosslinking followed by mass spectrometry analysis can identify interaction interfaces between SLC30A2 and its binding partners, providing structural insights into protein complexes.

How can systems biology approaches integrate SLC30A2 into zinc homeostasis networks?

Systems biology approaches can provide a comprehensive understanding of how SLC30A2 functions within broader zinc homeostasis networks:

Pathway NameRelated Proteins Connected to SLC30A2Functional Significance
Metal ion SLC transportersSLC39A2, SLC39A3, SLC30A5, SLC30A3, SLC39A7, SLC39A1, SLC30A1B, SLC30A1A, SLC39A5 Coordinated regulation of metal transport
Zinc transportersSLC39A6, SLC39A3, SLC30A1B, SLC30A3, SLC39A7, SLC39A10, SLC39A14, SLC30A1A, SLC39A8, SLC39A2 Zinc-specific transport pathways
Zinc efflux and compartmentalizationSLC30A3, SLC30A1A, SLC30A1B, SLC30A6, SLC30A5, SLC30A8 Regulation of subcellular zinc distribution
  • Multi-omics Integration: Combining transcriptomics, proteomics, and metabolomics data can reveal how SLC30A2 expression and activity correlate with global cellular responses to zinc availability and stress conditions.

  • Comparative Analysis Across Species: Comparing rat SLC30A2 with orthologs from other species can identify evolutionarily conserved regulatory mechanisms and functional interactions within zinc homeostasis networks.

What are common challenges in expressing functional recombinant rat SLC30A2 and how can they be addressed?

Researchers often encounter several challenges when expressing recombinant membrane proteins like SLC30A2:

  • Low Expression Levels: Membrane proteins often express poorly in heterologous systems.

    • Solution: Optimize codon usage for the expression host, use strong promoters, and explore different expression hosts (HEK293, insect cells, E. coli) .

    • Solution: Consider using fusion partners that enhance solubility and expression, such as MBP or SUMO tags.

  • Protein Misfolding: Incorrect folding can lead to non-functional protein.

    • Solution: Express the protein at lower temperatures to slow folding and allow proper membrane insertion.

    • Solution: Include molecular chaperones or optimize buffer conditions to promote proper folding.

  • Toxicity to Host Cells: Overexpression of membrane transporters can disrupt host cell homeostasis.

    • Solution: Use inducible expression systems to control expression timing and level.

    • Solution: Consider using zinc-depleted media during expression to minimize potential toxicity from zinc transport activity.

  • Purification Difficulties: Membrane proteins require detergents for solubilization.

    • Solution: Screen multiple detergents for optimal solubilization while maintaining protein function.

    • Solution: Use affinity tags positioned at accessible termini (N- or C-terminus) for efficient purification .

How can zinc uptake assays be optimized for accurate measurement of SLC30A2 function?

Optimizing zinc uptake assays requires attention to several key parameters:

  • Background Zinc Levels: Natural zinc in media can mask uptake measurements.

    • Solution: Use zinc-depleted media prepared with chelating resins like A12-resin, followed by controlled reintroduction of zinc .

    • Solution: Include appropriate controls with cells expressing empty vector to determine background uptake levels.

  • Timing of Measurements: Zinc uptake kinetics can vary.

    • Solution: Conduct time-course experiments to determine optimal incubation periods for linear uptake (typically 15 minutes for initial rate measurements) .

    • Solution: For steady-state measurements, longer incubations (up to 24 hours) may be necessary.

  • Buffer Composition: Transport activity is influenced by buffer components.

    • Solution: Optimize uptake buffer composition (e.g., 15 mM HEPES, 100 mM glucose, and 150 mM KCl, pH 7.0) for maximum activity .

    • Solution: Ensure the absence of chelating agents during the uptake period.

  • Detection Sensitivity: Conventional methods may lack sensitivity.

    • Solution: For non-radioactive approaches, use ICP-MS with isotopically enriched zinc (e.g., 70% 70Zn) for enhanced sensitivity .

    • Solution: For radioactive approaches, optimize washing procedures to minimize non-specific binding while preventing loss of specifically transported zinc.

What emerging technologies could advance our understanding of rat SLC30A2 function?

Several cutting-edge technologies show promise for deepening our understanding of SLC30A2 function:

  • Cryo-Electron Microscopy: This technique could reveal the high-resolution structure of SLC30A2, providing insights into zinc binding sites, conformational changes during transport, and the molecular basis of dimerization.

  • CRISPR-Cas9 Genome Editing: Generation of precise mutations in the endogenous SLC30A2 gene can help study its function in physiologically relevant contexts without overexpression artifacts.

  • Single-Molecule Imaging: Techniques that allow visualization of individual SLC30A2 molecules in live cells could reveal dynamics of transporter movement, clustering, and activity at unprecedented resolution.

  • Zinc-Specific Fluorescent Sensors: Development of improved zinc sensors with subcellular targeting capabilities could enable real-time monitoring of SLC30A2-mediated zinc transport in specific cellular compartments.

  • Advanced Mass Spectrometry: Improvements in quantitative proteomics can provide deeper insights into how SLC30A2 expression and interactome change under different physiological and pathological conditions.

How might understanding rat SLC30A2 contribute to translational research in human health and disease?

Research on rat SLC30A2 has several potential translational implications:

  • Neonatal Zinc Deficiency: Mutations in human SLC30A2 cause transient neonatal zinc deficiency due to low zinc concentrations in breast milk . Rat models with analogous mutations could help develop therapeutic strategies for this condition.

  • Neurodegenerative Diseases: Given SLC30A2's role in zinc transport in glutamatergic neurons and its impact on mitochondrial function , it may be relevant to neurodegenerative conditions where zinc homeostasis and mitochondrial function are disturbed.

  • Cancer Biology: Altered zinc homeostasis is associated with various cancers. Understanding SLC30A2's role in controlling intracellular zinc distribution could inform new approaches to cancer treatment, particularly in tissues where SLC30A2 is highly expressed.

  • Drug Development: The structure and function of SLC30A2 could serve as a basis for designing small molecules that modulate zinc transport, potentially offering therapeutic approaches for conditions associated with zinc dysregulation.

  • Biomarker Development: Expression patterns of SLC30A2 in specific tissues might serve as biomarkers for certain pathological conditions or for monitoring response to treatments targeting zinc homeostasis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.