Recombinant Rat Zinc transporter 3 (Slc30a3)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Rat Zinc Transporter 3 (Slc30a3)

Recombinant Rat Zinc Transporter 3, also known as Slc30a3, is a protein that plays a crucial role in zinc homeostasis within cells. It belongs to the solute carrier family 30 (SLC30A), which is responsible for transporting zinc ions across cellular membranes. This transporter is particularly significant in the brain, where it helps load zinc into synaptic vesicles, influencing neurotransmission and synaptic plasticity .

Characteristics of Recombinant Rat Zinc Transporter 3

The recombinant version of Rat Zinc Transporter 3 is often expressed in Escherichia coli (E. coli) and is available as a full-length protein with an N-terminal His tag. This tagging facilitates purification and detection of the protein. The recombinant protein consists of 388 amino acids and is provided in a lyophilized form, requiring reconstitution before use .

Function and Oligomerization of Zinc Transporter 3

Zinc Transporter 3 (ZnT3) is known for its role in modulating zinc levels within synaptic vesicles. The protein's function is regulated by its oligomerization state, which is influenced by covalent dityrosine bonds. These bonds form between specific tyrosine residues, such as tyrosine 357 and 372, and are enhanced under oxidative stress conditions .

Oligomerization Mechanism

  • Critical Tyrosine Residues: Tyrosine 357 and 372 are crucial for ZnT3 oligomerization. Mutations at these sites can either prevent or enhance dimer formation, affecting zinc transport capacity and resistance to zinc toxicity .

  • Effect of Oxidative Stress: Oxidative stress increases the formation of dityrosine bonds, thereby enhancing ZnT3 oligomerization and modulating its function .

Research Findings and Implications

Research on ZnT3 has highlighted its importance in neurological functions and potential implications in mental health disorders. Variants in the SLC30A3 gene have been associated with alterations in glutamatergic neurotransmission, which may contribute to conditions like schizophrenia and bipolar disorder .

Role in Neurological Disorders

  • Glutamatergic Neurotransmission: Variants in the SLC30A3 gene can affect glutamate levels in the brain, potentially influencing the pathophysiology of psychiatric disorders .

  • Cognitive Impairment: Genetic deletion of ZnT3 in mice leads to decreased zinc levels in the hippocampus and cortex, resulting in progressive cognitive deficits .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
Slc30a3; Znt3; Zinc transporter 3; ZnT-3; Solute carrier family 30 member 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-388
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Slc30a3
Target Protein Sequence
MEPSPASGGSETTRLVSPRDRSSAGGGLRLKSLFTEPSEPLPEGPKLEGMAFHHCHKNRV SQSGLSPERAQARRQLYAACVVCFIFMAGEVVGGYLAHSLAIMTDAAHLLADIGSMMASL FSLWLSTRPATRTMTFGWHRSETLGALASVVSLWIVTGILLYLAFLRLLHSDYHIEAGAM LLTASIAVCANMIMAFVLHQTGAPHSHGPRGAEYAPLEEGHGHPLSLGNTSVRAAFVHVL GDLLQSLGVLAASILIYFKPQYKVADPISTFLFSICALGSTAPTLRDVLLVLMEGAPRSV EFEPVRDTLLSVPGVRATHDLHLWALTLTYHVASAHLAIDSTADPEAILAEASSRLYSRF GFSSCTLQVEKYRSEMAHCLRCREPPKA
Uniprot No.

Target Background

Function
Involved in the accumulation of zinc within synaptic vesicles.
Gene References Into Functions
  • Zinc homeostasis dysfunction, resulting from decreased ZnT3 or ZnT10 expression, promotes senescence in vascular smooth muscle cells. PMID: 22427991
  • SLC30A3 (ZnT3) oligomerization via dityrosine bonds regulates its subcellular localization and metal transport capacity. PMID: 19521526
Database Links
Protein Families
Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family, SLC30A subfamily
Subcellular Location
Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane; Multi-pass membrane protein. Cell junction, synapse, synaptosome. Late endosome membrane; Multi-pass membrane protein. Lysosome membrane; Multi-pass membrane protein. Cytoplasmic vesicle, secretory vesicle, synaptic vesicle.

Q&A

What is Zinc Transporter 3 (SLC30A3) and what are its primary functions in neural systems?

Zinc Transporter 3 (SLC30A3), also known as ZnT3, is a member of the SLC30 family of zinc transporters that promotes the influx of zinc ions into synaptic vesicles of glutamatergic neurons from the cytoplasm, intracellular organelles, or to the extracellular environment. SLC30A3 plays a critical role in maintaining high intravesicular zinc content and is selectively located on the vesicles of zinc-secreting neurons, particularly in brain regions such as the hippocampus and neocortex. The protein is responsible for zinc homeostasis in neural systems, where ionic zinc (Zn²⁺) is fundamental for synaptic function and plasticity. ZnT3's structure is predicted to contain six transmembrane spanning domains that form a pore lined with a histidine-rich loop, which facilitates zinc transport across membranes .

What are the key structural features of recombinant rat SLC30A3 protein?

Recombinant rat SLC30A3 protein is characterized by several structural features that facilitate its zinc transport function. The protein is encoded by the Slc30a3 gene (Gene ID: 366568) in Rattus norvegicus with mRNA reference sequence NM_001013243.1 and protein reference sequence NP_001013261.1 (UniProt ID: Q6QIX3). The protein contains six predicted transmembrane domains with a histidine-rich loop between domains, which is crucial for zinc binding and transport. When expressed recombinantly, the protein maintains its structural integrity, including the transmembrane domains and the functional histidine-rich loop. The available recombinant formats include various tagged versions (His, Myc/DDK, His-MBP, His-Fc-Avi) that facilitate purification and detection while preserving the functional domains necessary for zinc transport activity .

How does the expression pattern of SLC30A3 differ across brain regions in rat models?

The expression of SLC30A3 in rat models shows a distinct regional pattern within the brain. Immunohistochemical studies using anti-ZnT3 antibodies have demonstrated that SLC30A3 is strongly expressed in the mossy fiber (MF) terminal field of the CA3 region in the rat hippocampus. This expression pattern significantly overlaps with synaptophysin staining, indicating its localization in synaptic vesicles. Beyond the hippocampus, SLC30A3 is expressed in glutamatergic terminals in the neocortex and amygdala—regions crucial for emotion, learning, and memory processes. The protein is notably absent or expressed at very low levels in other brain regions not associated with zinc-containing glutamatergic projections. This specific distribution pattern underscores the specialized role of SLC30A3 in regulating zinc homeostasis within specific neural circuits involved in cognitive and emotional processing .

What are the most effective methods for expressing and purifying recombinant rat SLC30A3 protein?

For expressing and purifying recombinant rat SLC30A3 protein, researchers have found success with mammalian expression systems, particularly HEK293 cells, which provide appropriate post-translational modifications and protein folding for this multi-transmembrane domain protein. The expression protocol typically involves:

  • Cloning the rat Slc30a3 gene (NM_001013243.1) into a mammalian expression vector with an appropriate tag (His, Myc/DDK, or His-MBP) to facilitate purification.

  • Transfecting HEK293 cells using either calcium phosphate precipitation or lipid-based transfection reagents, followed by selection of stable cell lines if needed.

  • Culturing cells in appropriate media supplemented with zinc (typically 10-50 μM ZnCl₂) to ensure proper folding of the zinc transporter.

  • Harvesting cells and solubilizing the membrane fraction using mild detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin that preserve protein structure and function.

  • Purifying the protein using affinity chromatography based on the fusion tag, followed by size exclusion chromatography to enhance purity.

This approach typically yields functional protein that can be used for structural studies, functional assays, or conjugation to substrates like magnetic beads for specialized applications .

How can recombinant rat SLC30A3 pre-coupled magnetic beads be used for protein interaction studies?

Recombinant rat SLC30A3 pre-coupled magnetic beads provide a powerful tool for studying protein interactions in the context of zinc transport mechanisms. These ready-to-use beads feature the protein conjugated to uniform-sized (~2 μm) hydrophilic magnetic particles with a high surface area, offering several methodological advantages:

  • Co-immunoprecipitation studies: The beads can capture protein binding partners from cell or tissue lysates, particularly from rat brain samples, allowing identification of novel SLC30A3 interactors. After incubation with lysates, bound proteins can be eluted and analyzed by mass spectrometry or Western blotting.

  • Pull-down assays: Researchers can use these beads to validate direct protein-protein interactions by incubating with purified candidate proteins and assessing binding through appropriate detection methods.

  • Zinc-dependent interaction studies: By pre-loading the beads with varying concentrations of zinc, researchers can investigate how zinc levels modulate protein interactions with SLC30A3.

  • High-throughput screening: The beads' compatibility with automation equipment enables large-scale screening for compounds or proteins that interact with SLC30A3.

For optimal results, researchers should maintain the beads at 2-8°C without freeze-thaw cycles and use them within 6 months in PBS buffer to preserve the integrity of the conjugated protein and ensure reproducible interaction studies .

What antibody-based approaches are most effective for detecting and localizing SLC30A3 in rat brain tissues?

For detecting and localizing SLC30A3 in rat brain tissues, several antibody-based approaches have proven effective, with specific optimization parameters:

  • Western blot analysis: Polyclonal antibodies directed against epitopes such as the peptide (C)RGAEYAPLEEGHGH (corresponding to amino acid residues 210-223 of rat ZnT3) show high specificity. Optimal dilutions range from 1:200 to 1:500 for rat brain lysates. It's crucial to include appropriate blocking peptides as controls to confirm specificity.

  • Immunohistochemistry on free-floating sections: For immersion-fixed, free-floating rat brain frozen sections, a 1:600 dilution of anti-ZnT3 antibodies provides excellent results. This approach clearly reveals ZnT3 expression in the mossy fiber terminal field of the CA3 hippocampal region.

  • Fluorescent co-localization studies: Combining anti-ZnT3 antibodies with markers like synaptophysin allows visualization of co-localization in synaptic structures. This technique is particularly valuable for examining the precise subcellular distribution of SLC30A3.

  • Electron microscopy immunogold labeling: For ultrastructural localization, immunogold approaches using anti-ZnT3 antibodies can precisely localize the protein to synaptic vesicle membranes.

For all these applications, proper controls including preincubation with specific blocking peptides are essential to confirm signal specificity and avoid cross-reactivity with other members of the zinc transporter family .

How do SLC30A3 genetic variants (particularly rs11126936 and rs11126929) affect brain function in neuropsychiatric disorders?

SLC30A3 genetic variants, particularly rs11126936 (G/T) and rs11126929 (A/G), have demonstrated significant impacts on brain function in neuropsychiatric disorders through several mechanisms:

  • Glutamatergic neurotransmission alterations: In patients with schizophrenia (SCZ), carriers of at least one copy of the minor allele showed reductions in dorsal anterior cingulate cortex glutamate levels during cognitive tasks (n-back), whereas those without the minor allele exhibited increased glutamate. This suggests these variants modulate glutamatergic signaling differentially during cognitive processing.

  • Bipolar disorder effects: In patients with bipolar affective disorder type 2 (BD), the presence of the minor allele was associated with reduced glutamate concentrations in the anterior cingulate cortex, suggesting a potential mechanistic link to mood regulation.

  • Cognitive task performance: The minor allele's presence appears to reduce brain activation during cognitive tasks regardless of diagnosis, indicating these variants may affect neural efficiency or resource allocation during cognitive processing.

These findings come from functional magnetic resonance spectroscopy (¹H-fMRS) studies analyzing glutamate dynamics during cognitive tasks. Importantly, these SNPs (rs11126936 and rs11126929) exist in strong linkage disequilibrium (r² = 1), explaining their identical effects. The region containing rs11126929 represents a potential binding site for POLR2A, while rs11126936 shows the highest RegulomeDB score, likely affecting the upstream gene ATRAID. Together, these data support the role of ZnT3 in modulating glutamatergic neurotransmission and its involvement in the pathophysiology of schizophrenia and mood disorders .

What methodologies are recommended for investigating the relationship between SLC30A3 genetic variants and major depressive disorder (MDD)?

For investigating the relationship between SLC30A3 genetic variants and major depressive disorder (MDD), a comprehensive methodological approach combining genetic, neuroimaging, and clinical assessments is recommended:

  • Case-control genetic association studies: Using matched case-control designs (1:1 ratio) with careful consideration of demographic variables (age, gender, ethnicity). For robust statistical power, sample sizes of at least 300 cases and 300 controls are recommended based on previous findings.

  • Genotyping methodologies:

    • PCR-restriction fragment length polymorphism analysis for initial screening

    • Validation through sequencing of approximately 10% of samples to ensure accuracy

    • KASP™ assay method (Kompetitive Allele Specific PCR) for high-throughput genotyping

  • Statistical analysis approach:

    • Hardy-Weinberg equilibrium testing using chi-square tests

    • Conditional logistic regression to estimate adjusted odds ratios

    • Control for confounding variables including age, gender, ethnicity, occupation, and socioeconomic factors

  • Functional validation studies:

    • Proton magnetic resonance spectroscopy (¹H-MRS) to assess glutamatergic neurochemistry

    • Functional magnetic resonance imaging (fMRI) during cognitive tasks

    • Analysis of the relationship between genotype and cognitive performance

Previous research has demonstrated that carriers of genotypes G/G and G/T of the SNP rs11126936 in SLC30A3 show approximately twice the odds of developing MDD compared to the T/T variant (OR=1.983, 95% CI=1.031-3.815; p=0.040 and OR=2.232, 95% CI=1.100-4.533; p=0.026 respectively), highlighting the importance of this methodological approach in understanding the genetic basis of depression .

How can researchers design experiments to investigate the role of SLC30A3 in modulating glutamatergic neurotransmission?

Designing experiments to investigate SLC30A3's role in glutamatergic neurotransmission requires a multi-level approach integrating molecular, cellular, and systems neuroscience techniques:

  • In vitro electrophysiology:

    • Prepare hippocampal or cortical slice cultures from rats with varying SLC30A3 expression levels (wildtype, knockout, or overexpressing)

    • Conduct whole-cell patch-clamp recordings from glutamatergic neurons to measure:

      • Miniature excitatory postsynaptic currents (mEPSCs)

      • Evoked synaptic transmission

      • NMDA and AMPA receptor-mediated currents

    • Apply zinc chelators (e.g., TPEN) or zinc donors to assess how zinc modulation affects synaptic transmission

  • Functional neuroimaging combined with genetic analysis:

    • Recruit participants genotyped for SLC30A3 variants (particularly rs11126936 and rs11126929)

    • Perform proton functional magnetic resonance spectroscopy (¹H-fMRS) during cognitive tasks (e.g., n-back)

    • Measure glutamate/glutamine ratios and dynamics in regions like the anterior cingulate cortex

    • Compare glutamatergic responses between genotype groups

  • Advanced molecular imaging techniques:

    • Utilize zinc-specific fluorescent probes (e.g., FluoZin-3) in combination with glutamate sensors

    • Perform real-time imaging of zinc release in response to synaptic activity

    • Correlate zinc dynamics with glutamate release in SLC30A3-expressing terminals

This integrated approach would provide comprehensive insights into how SLC30A3-mediated zinc transport modulates glutamatergic signaling at molecular, cellular, and systems levels, with particular relevance to understanding the mechanistic basis of psychiatric disorders like schizophrenia and bipolar disorder .

What are the most precise techniques for measuring SLC30A3-mediated zinc transport in synaptic vesicles?

Measuring SLC30A3-mediated zinc transport in synaptic vesicles requires specialized techniques that can detect zinc movement with high spatial and temporal resolution. The following methodologies provide the most precise quantification:

  • Synaptic vesicle isolation and zinc uptake assays:

    • Isolate synaptic vesicles from rat brain tissue using differential centrifugation and sucrose gradient purification

    • Incubate purified vesicles with ⁶⁵Zn²⁺ as a radioactive tracer

    • Measure zinc uptake kinetics using filtration assays under varying conditions:

      • ATP-dependent vs. independent transport

      • Concentration gradients (0.1-100 μM zinc)

      • pH dependence (pH 5.5-7.5)

      • Effects of transport inhibitors

  • Zinc-sensitive fluorescent probes in reconstituted systems:

    • Reconstitute recombinant rat SLC30A3 into proteoliposomes

    • Load proteoliposomes with zinc-sensitive fluorescent dyes (FluoZin-3)

    • Measure fluorescence changes in response to zinc gradients using stopped-flow spectrofluorometry

    • Calculate transport rates and substrate affinities

  • Single-vesicle zinc imaging:

    • Use dual-color total internal reflection fluorescence (TIRF) microscopy

    • Label synaptic vesicles with pH-sensitive markers (synaptopHluorin) and zinc-sensitive probes

    • Simultaneously monitor vesicle fusion and zinc release

    • Compare kinetics between wildtype and SLC30A3-deficient preparations

  • Nanoscale secondary ion mass spectrometry (NanoSIMS):

    • Utilize high-resolution isotope imaging to detect zinc isotopes in individual synaptic vesicles

    • Compare zinc content in vesicles from different genetic backgrounds

    • Correlate with electron microscopy for ultrastructural context

These complementary approaches provide comprehensive measurement of SLC30A3-mediated zinc transport, from isolated vesicles to intact synapses, revealing both the kinetics and regulatory mechanisms governing this critical process .

How does zinc modulation via SLC30A3 influence NMDA receptor function in the context of synaptic plasticity?

Zinc modulation via SLC30A3 exerts complex effects on NMDA receptor function and synaptic plasticity through multiple mechanisms:

  • Direct NMDA receptor modulation:

    • Zinc released from SLC30A3-containing vesicles acts as an allosteric modulator of NMDA receptors

    • At nanomolar concentrations (10-100 nM), zinc selectively inhibits GluN2A-containing NMDA receptors through high-affinity binding to the N-terminal domain

    • At micromolar concentrations (1-100 μM), zinc inhibits GluN2B-containing receptors through lower-affinity interactions

    • This subunit-specific modulation creates a concentration-dependent fine-tuning of synaptic NMDA receptor activity

  • Indirect effects on glutamatergic transmission:

    • Zinc released via SLC30A3 activates metabotropic zinc-sensing receptors (mZnRs)

    • mZnR activation triggers intracellular signaling cascades that modulate protein kinases (PKC, CaMKII)

    • These kinases phosphorylate AMPA and NMDA receptors, altering their trafficking and channel properties

    • SLC30A3-mediated zinc release can thus modulate synaptic strength bidirectionally

  • Long-term plasticity regulation:

    • During high-frequency stimulation, SLC30A3-dependent zinc release can:

      • Prevent excessive NMDA receptor activation, protecting against excitotoxicity

      • Modulate the threshold for long-term potentiation (LTP) induction

      • Influence long-term depression (LTD) through effects on metaplasticity

  • Zinc-dependent structural plasticity:

    • Zinc released via SLC30A3 activates matrix metalloproteinases (MMPs)

    • MMPs remodel the extracellular matrix and influence dendritic spine morphology

    • This remodeling supports structural changes associated with synaptic plasticity

These mechanisms establish SLC30A3 as a critical regulator of NMDA receptor function and synaptic plasticity, with implications for learning, memory, and neuropsychiatric disorders characterized by glutamatergic dysfunction .

What are the most common challenges when working with recombinant SLC30A3 and how can they be addressed?

Working with recombinant SLC30A3 presents several challenges due to its multi-transmembrane domain structure and specific functional requirements. Here are the most common issues and recommended solutions:

  • Low expression levels:

    • Challenge: SLC30A3, as a multi-transmembrane protein, often expresses poorly in heterologous systems.

    • Solutions:

      • Use mammalian expression systems like HEK293 cells rather than bacterial systems

      • Optimize codon usage for the expression host

      • Include fusion tags that enhance folding and stability (MBP, SUMO)

      • Supplement growth media with 10-50 μM ZnCl₂ to facilitate proper folding

      • Lower expression temperature to 30°C to slow protein synthesis and improve folding

  • Protein misfolding and aggregation:

    • Challenge: The complex topology of SLC30A3 leads to misfolding and aggregation.

    • Solutions:

      • Add chemical chaperones (4% glycerol, 1 M sorbitol) to culture media

      • Include protein stabilizers during purification (5-10% glycerol, 0.5 M trehalose)

      • Perform solubility screening with different detergents (DDM, LMNG, GDN)

      • Purify at 4°C with protease inhibitors to minimize degradation

  • Loss of function after purification:

    • Challenge: Purified SLC30A3 often loses zinc transport activity.

    • Solutions:

      • Maintain constant zinc concentration in all buffers (1-5 μM)

      • Include lipids (0.1-0.5 mg/ml brain extract) during purification

      • Use mild solubilization conditions and avoid harsh detergents

      • Consider nanodiscs or SMALPs for maintaining the native lipid environment

  • Difficulties in functional assays:

    • Challenge: Assessing zinc transport function of recombinant SLC30A3.

    • Solutions:

      • Reconstitute purified protein into proteoliposomes for transport assays

      • Use zinc-sensitive fluorescent dyes (FluoZin-3) for real-time monitoring

      • Employ radioactive ⁶⁵Zn²⁺ for more sensitive quantitative assays

      • Establish stable cell lines expressing SLC30A3 for cellular zinc imaging

These approaches significantly improve the yield, stability, and functionality of recombinant SLC30A3, enabling more reliable experimental outcomes .

How can researchers differentiate between the effects of SLC30A3 genetic variants and other factors in neuropsychiatric disorder studies?

Differentiating between the effects of SLC30A3 genetic variants and other contributing factors in neuropsychiatric disorder studies requires robust experimental design and statistical approaches:

  • Genetic stratification and matching:

    • Match cases and controls (1:1) for demographic factors (age, gender, ethnicity)

    • Stratify participants by SLC30A3 genotype (particularly rs11126936 and rs11126929)

    • Control for other relevant genetic variants that might interact with SLC30A3 or independently affect the phenotype

    • Assess linkage disequilibrium patterns to distinguish variant-specific effects

  • Medication and treatment effects:

    • Document detailed medication histories, including antipsychotics, antidepressants, and mood stabilizers

    • Perform subanalyses comparing medicated vs. unmedicated patients

    • Consider medication-genotype interactions in statistical models

    • When possible, include medication-naïve patients as a reference group

  • Statistical approaches to isolate genetic effects:

    • Use conditional logistic regression adjusting for confounding variables

    • Employ propensity score matching to balance confounding factors across genotype groups

    • Conduct mediation analyses to determine if SLC30A3 effects operate through intermediate phenotypes

    • Implement structural equation modeling to differentiate direct and indirect effects

  • Endophenotype approaches:

    • Focus on neurobiological measures more directly linked to SLC30A3 function:

      • Glutamate levels measured by MRS

      • Zinc homeostasis markers

      • Cognitive function in specific domains affected by zinc signaling

    • These intermediate phenotypes may show clearer genetic associations than broad diagnostic categories

A comprehensive example from previous research demonstrated that patients with schizophrenia carrying the minor allele of SLC30A3 variants showed reductions in glutamate during cognitive tasks, while those without the minor allele showed increases in glutamate. This approach successfully isolated genotype effects from general disease effects by examining specific neurobiological responses rather than just diagnostic status .

What considerations are important when designing cross-species studies comparing human and rat SLC30A3 function?

When designing cross-species studies comparing human and rat SLC30A3 function, several critical considerations ensure valid translation between models:

  • Sequence and structural homology assessment:

    • Conduct detailed alignment analyses of human and rat SLC30A3 proteins (human SLC30A3 vs. rat Slc30a3)

    • Identify conserved domains (transmembrane regions, zinc-binding motifs, regulatory sites)

    • Map species-specific variations, particularly in functional regions

    • Create the following comparison table for reference:

    FeatureHuman SLC30A3Rat Slc30a3Homology (%)Functional Impact
    Amino acid length388388-Identical length
    Transmembrane domains66~95%High conservation
    Histidine-rich loopPresentPresent~92%Similar zinc binding
    N-glycosylation sites2-32-3~90%Comparable processing
    Regulatory phosphorylation sites5-65-6~85%Some species-specific regulation
  • Expression pattern comparisons:

    • Compare regional and cellular expression patterns between species using:

      • RNA-seq data from equivalent brain regions

      • Immunohistochemistry with species-specific antibodies

      • In situ hybridization for mRNA localization

    • Document species differences in developmental expression trajectories

    • Note differences in cell-type specificity (neuronal vs. glial expression)

  • Functional assay standardization:

    • Develop parallel protocols for both species using:

      • Identical expression systems (e.g., HEK293 cells for both proteins)

      • Matched methodologies for zinc transport measurement

      • Consistent buffer compositions and experimental conditions

    • Assess transport kinetics, substrate specificity, and regulatory mechanisms under identical conditions

    • Interpret differences in the context of physiological zinc concentrations in each species

  • Genetic variant translation:

    • Identify whether human variants (e.g., rs11126936, rs11126929) have equivalent positions in rat Slc30a3

    • For human variants lacking direct rat equivalents, consider engineering corresponding mutations in rat models

    • Create transgenic rat models expressing human variants for direct functional studies

  • Physiological context differences:

    • Account for species differences in:

      • Brain size and regional organization

      • Zinc concentration in relevant brain regions

      • Synaptic density and connectivity patterns

      • Baseline glutamatergic signaling properties

These considerations enhance the translational value of cross-species SLC30A3 studies, enabling more accurate extrapolation between rat models and human conditions, particularly for neuropsychiatric disorders with SLC30A3 involvement .

What are the most promising therapeutic targets related to SLC30A3 function in neuropsychiatric disorders?

Based on current research, several promising therapeutic targets related to SLC30A3 function in neuropsychiatric disorders warrant investigation:

These approaches offer considerable promise for developing novel treatments for schizophrenia, bipolar disorder, and major depressive disorder, particularly in patients carrying SLC30A3 risk variants. Future therapeutic development should focus on precision medicine approaches tailored to specific genetic and neurobiological profiles .

How might advanced genome editing techniques be applied to study SLC30A3 function in neuropsychiatric disorders?

Advanced genome editing techniques offer revolutionary approaches to study SLC30A3 function in neuropsychiatric disorders, providing unprecedented precision and versatility:

  • CRISPR-Cas9 knock-in models of human variants:

    • Generate rat models carrying exact human SLC30A3 variants (rs11126936, rs11126929)

    • Create isogenic cell lines differing only in SLC30A3 variant status

    • Introduce fluorescent tags at endogenous loci for live imaging of protein localization

    • Engineer conditional alleles for temporal and spatial control of SLC30A3 expression

  • Base and prime editing applications:

    • Use base editing to introduce single nucleotide changes without double-strand breaks

    • Apply prime editing for precise insertion or deletion of specific sequences

    • Create libraries of SLC30A3 variants to systematically map structure-function relationships

    • Perform high-throughput screening of variant effects on zinc transport

  • Cell-type specific manipulations in vivo:

    • Employ Cre-dependent CRISPR systems for neuron-specific SLC30A3 editing

    • Target glutamatergic neurons in specific brain regions (hippocampus, prefrontal cortex)

    • Create mosaic animals to study cell-autonomous vs. non-autonomous effects

    • Combine with optical techniques for simultaneous manipulation and recording

  • Transcriptional modulation approaches:

    • Apply CRISPRa (activation) to upregulate endogenous SLC30A3 expression

    • Use CRISPRi (interference) to achieve graduated knockdown of SLC30A3

    • Target regulatory elements to understand transcriptional control

    • Perform epigenome editing to modify chromatin state at the SLC30A3 locus

  • Integration with advanced phenotyping:

    • Combine genome editing with in vivo calcium/zinc imaging

    • Link genetic modifications to electrophysiological recordings

    • Correlate molecular changes with behavioral phenotypes relevant to neuropsychiatric symptoms

    • Implement longitudinal studies to track developmental effects of SLC30A3 modifications

These approaches can help resolve key questions about SLC30A3 function in psychiatric disorders, including how specific variants affect zinc transport, glutamatergic signaling, and neural circuit function. The ability to precisely modify the genome in relevant model systems provides a powerful platform for understanding disease mechanisms and developing targeted therapeutic strategies .

What experimental approaches could identify novel interaction partners of SLC30A3 relevant to zinc transport and neuropsychiatric disorders?

Identifying novel interaction partners of SLC30A3 requires comprehensive experimental approaches spanning from unbiased screening to targeted validation:

  • Proximity-dependent biotinylation (BioID/TurboID):

    • Express SLC30A3-BioID fusion proteins in neuronal cultures or brain tissue

    • Allow biotin labeling of proximal proteins in their native cellular environment

    • Purify biotinylated proteins and identify by mass spectrometry

    • Compare interactomes between wild-type SLC30A3 and disease-associated variants

    • This approach can capture both stable and transient interactions in living cells

  • Cross-linking mass spectrometry (XL-MS):

    • Treat neurons or brain tissue expressing SLC30A3 with membrane-permeable crosslinkers

    • Isolate SLC30A3 complexes under stringent conditions

    • Digest and analyze by mass spectrometry to identify crosslinked peptides

    • Map interaction interfaces at amino acid resolution

    • Differentially analyze zinc-replete and zinc-depleted conditions

  • Split-protein complementation assays:

    • Create libraries of neuronal proteins fused to complementary fragments of reporter proteins

    • Screen against SLC30A3 fused to the corresponding fragment

    • Validate positive interactions in neuronal contexts

    • Assess how disease-relevant conditions affect interaction dynamics

  • Genetic interaction screening:

    • Perform CRISPR screens in neuronal models with and without SLC30A3 expression

    • Identify genes showing synthetic interactions with SLC30A3 deficiency

    • Focus on candidates related to zinc homeostasis, vesicular transport, and synaptic function

    • Validate hits using single and combinatorial gene manipulations

  • Quantitative interactome analysis under disease-relevant conditions:

    • Compare SLC30A3 interaction partners under conditions mimicking neuropsychiatric disorders:

      • Altered zinc levels

      • Oxidative stress

      • Inflammatory conditions

      • Presence of disease-associated SLC30A3 variants

    • Quantify interaction strength changes using SILAC or TMT labeling

    • Correlate interaction dynamics with functional outcomes

These complementary approaches would create a comprehensive interaction map of SLC30A3, revealing how this zinc transporter functions within broader protein networks in neurons. Identifying novel interaction partners could unveil unexpected mechanisms linking zinc transport to glutamatergic signaling and provide new therapeutic targets for neuropsychiatric disorders associated with SLC30A3 dysfunction .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.