Recombinant Rat Zinc transporter 7 (Slc30a7)

Shipped with Ice Packs
In Stock

Description

Biological Functions

Slc30a7 plays essential roles in:

  • Zinc Homeostasis: Transporting cytoplasmic zinc into the Golgi lumen to activate zinc-dependent enzymes like alkaline phosphatases .

  • Metabolic Regulation: Influencing insulin synthesis, adiposity, and dietary zinc absorption in rodent models .

  • Disease Relevance:

    • Knockout mice exhibit reduced zinc content in pancreatic islets, mild growth defects, and altered fat metabolism .

    • Human mutations in SLC30A7 are linked to stunted growth, bone marrow failure, and testicular hypoplasia .

Research Applications

Recombinant Slc30a7 is widely used in:

  • Mechanistic Studies: Investigating zinc transport mechanisms in secretory pathways .

  • Disease Models:

    • Prostate cancer progression is accelerated in Slc30a7-null TRAMP mice, suggesting tumor-suppressive roles .

    • Impaired zinc storage due to SLC30A7 mutations correlates with syndromic disorders in humans .

  • Biochemical Assays: Utilized in Western blotting (1:500–1:2000 dilution) and immunohistochemistry (1:50–1:200 dilution) .

Comparative Insights

FeatureRat Slc30a7Human SLC30A7
Tissue ExpressionHigh in liver, intestine, and brainUbiquitous, with elevated hepatic levels
Cellular RoleGolgi zinc loadingSimilar, with ER/mitochondrial coupling
Pathological ImpactProstate cancer acceleration in miceGrowth retardation and bone marrow failure

Key Research Findings

  • Knockout Phenotypes:

    • Combined deletion of Slc30a7 and Slc30a8 in mice reduces islet zinc content by ~80%, though fasting glucose remains unaffected .

    • Slc30a7 deficiency alters insulin dynamics and adipocyte function .

  • Clinical Cases:

    • Compound heterozygous SLC30A7 variants (e.g., c.21dup and c.842+15T>C) reduce ZnT7 protein levels by 80–96%, causing growth and hematological defects .

Technical Notes

  • Handling: Contains sodium azide, requiring careful handling .

  • Limitations: Species-specific reactivity (rat-specific antibodies may not cross-react with human orthologs) .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Note: While tag type is determined during production, we can prioritize your specified tag type upon request.
Synonyms
Slc30a7; Znt7; Zinc transporter 7; ZnT-7; Solute carrier family 30 member 7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-378
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MLPLSIKDDEYKPPKFNLFGKISGWFRSILSDKTSRNLFFFLCLNLSFAFVELLYGIWSN CLGLISDSFHMFFDSTAILAGLAASVISKWRDNDAFSYGYVRAEVLAGFVNGLFLIFTAF FIFSEGVERALAPPDVHHERLLLVSILGFVVNLVGIFVFNHGGHGHSHGSGHGHSHSLFN GALDHSHGHEDHCHSHGAKHGGAHSHDHDHAHGHGHLHSHDGPSFKETAGPSRQILQGVF LHILADTLGSIGVIASAIMMQNFGLMIADPICSILIAILIVVSVIPLLRESIGILMQRTP PSLENVLPQCYQRVQQLQGVYNLQEQHFWTLCSDVYVGTLKLVVAPDADARWILSQTHNI FTQAGVRQLYVQIDFAAM
Uniprot No.

Target Background

Function
Zinc transporter 7 (ZnT7) facilitates zinc transport from the cytoplasm to the Golgi apparatus, contributing to cellular zinc homeostasis. It is essential, in conjunction with ZNT5, for activating zinc-dependent enzymes, such as alkaline phosphatases (ALPs). ZnT7 transports zinc into the Golgi lumen and vesicular compartments containing ALPs, enabling the conversion of apoALPs to holoALPs. In collaboration with ZNT5 and ZNT6, it is also required for TNAP activation.
Gene References Into Functions
  1. Evidence suggests a protective role of ZnT7 against epithelial-to-mesenchymal transition (EMT) in renal tubular epithelial cells during diabetic nephropathy, potentially through the MAPK/ERK and TGF-β/Smad pathways. PMID: 29627824
  2. Studies observed significantly elevated mRNA and protein levels of ZIP7 in ventricular cardiomyocytes from diabetic rats and high-glucose-treated H9c2 cells, while ZnT7 expression was reduced. PMID: 28232492
  3. The recurrent seizures plus normal diet group exhibited impaired neurological reflexes and reduced latency to penicillin-induced myoclonic seizures, correlating with altered expression levels of ZnT-7, MT-1, MT-2, and ZIP7. PMID: 27147436
  4. Data indicate that ZnT7 (Slc30A7) may inhibit high-glucose (HG)-induced EMT in peritoneal mesothelial cells (PMCs). PMID: 23104082
Database Links
Protein Families
Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family, SLC30A subfamily
Subcellular Location
Golgi apparatus, trans-Golgi network membrane; Multi-pass membrane protein.

Q&A

What is Zinc Transporter 7 (Slc30a7) and what is its primary function?

Zinc Transporter 7 (ZnT7) is a protein encoded by the Slc30a7 gene located on chromosome 1 in humans. It belongs to the solute carrier family 30 (SLC30A) of zinc transporters, which are responsible for regulating zinc homeostasis in cells. The primary function of ZnT7 is to mediate the movement of zinc ions from the cytosol into the lumen of organelles within the secretory pathway. This function is crucial for maintaining zinc ion homeostasis in these cellular compartments, which is vital for the proper activation and folding of enzymes like alkaline phosphatases . ZnT7 is predominantly localized to the Golgi apparatus, as demonstrated by immunocytochemistry studies using specific antibodies against SLC30A7 . Unlike some other zinc transporters that function primarily at the plasma membrane, ZnT7 operates intracellularly to ensure appropriate zinc distribution to secretory pathway organelles.

How is Slc30a7 expression regulated in different tissues?

Slc30a7 expression varies across different tissues and can be regulated by various physiological and pathological conditions. In pancreatic islets, Slc30a7 is expressed at low levels compared to other zinc transporters like Slc30a8, but it still plays a critical role in islet function . Studies have shown that certain conditions like high glucose (HG) can strongly induce the expression of ZnT7 mRNA, suggesting a glucose-responsive regulatory mechanism for this transporter . In the digestive system, ZnT7 shows strong expression in the luminal membrane of glandular cells in the small intestine, as revealed by immunohistochemistry studies . The tissue-specific expression patterns of Slc30a7 reflect its specialized functions in different cellular contexts.

Expression regulation of Slc30a7 also involves transcriptional control mechanisms that respond to zinc status and metabolic signals. Under high glucose conditions, the increased expression of ZnT7 appears to be part of a cellular adaptive response aimed at protecting cells from apoptosis, as observed in peritoneal mesothelial cells . This glucose-responsive expression pattern suggests that Slc30a7 may play a particularly important role in tissues affected by diabetes and other metabolic disorders, explaining why it has become a focus of research in these areas.

What are the best detection methods for studying Slc30a7 expression and localization?

Several reliable methods have been validated for detecting Slc30a7 expression and localization in research settings. At the transcript level, real-time polymerase chain reaction (RT-PCR) has been successfully used to quantitatively measure Slc30a7 mRNA levels in various cell types, including primary rat peritoneal mesothelial cells (RPMCs) . For protein detection, Western blotting using specific antibodies against SLC30A7 provides reliable results, especially when validated with appropriate controls such as SLC30A7 overexpression lysates compared to vector-only transfected lysates . Immunocytochemistry and immunofluorescence techniques have proven effective for determining the subcellular localization of ZnT7, consistently showing its predominant localization to the Golgi apparatus in human cell lines like A-431 .

For tissue-level expression studies, immunohistochemistry on paraffin-embedded sections yields valuable insights, as demonstrated by the strong positive staining of the luminal membrane in glandular cells of human small intestine . When designing experiments to detect Slc30a7, researchers should consider using multiple detection methods to corroborate findings, as each technique provides different aspects of information regarding expression levels and subcellular localization. Commercially available antibodies against SLC30A7 have been validated for research applications, although it's important to note that these are typically recommended for research use only and not for clinical diagnosis .

How can researchers effectively design knockout or knockdown studies for Slc30a7?

Designing effective knockout or knockdown studies for Slc30a7 requires careful consideration of several factors to ensure valid and interpretable results. For genetic knockout approaches, researchers have successfully employed homologous recombination in ES cells to replace critical exons (specifically exons 1 and 2) with a LacZ/Neo cassette, as demonstrated in mouse models . This design not only abolishes Slc30a7 expression but can also enable tracking of the endogenous promoter activity by utilizing the LacZ reporter gene expression. Confirmation of successful gene targeting should be conducted using multiple methods, such as Southern blot analysis and PCR, followed by verification of reduced zinc content in relevant tissues using zinc-specific assays .

For transient knockdown studies, siRNA-mediated approaches have been effectively used to reduce ZnT7 expression in cell culture models. When designing siRNA experiments, researchers should consider using multiple siRNA sequences targeting different regions of the Slc30a7 transcript to minimize off-target effects . Verification of knockdown efficiency at both mRNA and protein levels is essential before proceeding to functional studies. Additionally, researchers should be aware that compensation by other zinc transporters might occur in response to Slc30a7 deletion or knockdown, potentially masking phenotypic effects. This consideration is particularly important given the evidence that ZnT7 and ZnT8 can functionally compensate for each other in pancreatic islets . Therefore, combinatorial approaches targeting multiple zinc transporters simultaneously might be necessary to fully unmask the functional importance of Slc30a7 in certain contexts.

What experimental approaches can determine the functional interaction between Slc30a7 and Slc30a8 in pancreatic islets?

Investigating the functional interaction between Slc30a7 and Slc30a8 in pancreatic islets requires sophisticated experimental approaches that can dissect their individual and combined roles. A powerful strategy involves generating single and double knockout mouse models, as demonstrated by studies where Slc30a7 knockout mice were interbred with Slc30a8 knockout mice to generate double knockout (DKO) animals . These genetic models enable comparative analyses of phenotypes between wild-type, single knockout, and double knockout animals to reveal functional redundancies or synergistic effects. Key functional parameters to assess include glucose tolerance through in vivo glucose tolerance tests, glucose-stimulated insulin secretion (GSIS) in isolated islets, and zinc content measurements using zinc-specific assays .

Beyond knockout approaches, overexpression studies in relevant cell models can provide complementary insights into functional interactions. For instance, researchers can examine whether overexpression of one transporter can rescue defects caused by the absence of the other. Molecular interaction studies using co-immunoprecipitation, proximity ligation assays, or advanced microscopy techniques like FRET (Fluorescence Resonance Energy Transfer) can determine whether these transporters physically interact or co-localize in subcellular compartments. Additionally, examination of islet morphology, including the ratio of α- to β-cells, and assessment of pancreatic insulin content provide critical information about the impact of these transporters on islet development and function . When designing these experiments, researchers should carefully control for genetic background effects and consider age-dependent changes in phenotypes, as metabolic parameters can vary significantly across the lifespan.

How does Slc30a7 structure inform its function in zinc transport mechanisms?

The structural characteristics of Slc30a7 provide crucial insights into its zinc transport mechanism and functional properties. Recent high-resolution cryo-electron microscopy (cryo-EM) studies of human ZnT7 have revealed that it exists as a dimer with tight interactions in both the cytosolic and transmembrane (TM) domains between two protomers . Each protomer contains a single zinc-binding site in its transmembrane domain, which is essential for its zinc transport function. The structural data demonstrate that ZnT7 undergoes significant transmembrane helix rearrangements during the transport cycle, creating a negatively charged cytosolic cavity for zinc entry in the inward-facing conformation and widening the luminal cavity in the outward-facing state . These conformational changes are critical for facilitating the movement of zinc ions across the membrane barrier.

Understanding the structure-function relationship of Slc30a7 has important implications for experimental design in research. When creating recombinant constructs or studying mutations, researchers should consider how alterations might affect the dimeric interface, zinc-binding sites, or the conformational changes required for transport. Mutations in key residues involved in zinc coordination can be particularly informative for dissecting the transport mechanism. Furthermore, the structural insights suggest that Slc30a7 likely functions as a Zn²⁺/H⁺ antiporter, exchanging zinc ions for protons across membranes . This mechanistic detail is important for designing appropriate functional assays, as the transport activity may depend on both zinc gradients and pH conditions across the membrane. Researchers studying Slc30a7 transport kinetics should therefore consider incorporating pH controls and measurements in their experimental protocols.

What is the role of Slc30a7 in glucose metabolism and diabetes?

Slc30a7 plays a significant role in glucose metabolism, with important implications for diabetes research. Studies using Slc30a7 knockout mouse models have revealed complex effects on whole-body glucose homeostasis. Deletion of Slc30a7 alone impairs glucose tolerance and reduces glucose-stimulated increases in plasma insulin levels, hepatic glycogen levels, and pancreatic insulin content, indicating its importance in normal glucose metabolism . Interestingly, while Slc30a7 deletion affects islet morphology and increases the ratio of islet α- to β-cells, deletion of Slc30a7 alone had no effect on glucose-stimulated insulin secretion (GSIS) in isolated islets . This suggests that the in vivo metabolic effects may involve complex interorgan communication beyond direct effects on β-cell function.

The relationship between Slc30a7 and diabetes becomes particularly intriguing when considered alongside Slc30a8, another zinc transporter associated with type 2 diabetes (T2D) risk in humans. Polymorphisms in the SLC30A8 gene are associated with altered susceptibility to T2D, and SLC30A8 haploinsufficiency is protective against the development of T2D in obese humans . The observation that combined deletion of Slc30a7 and Slc30a8 abolishes GSIS in isolated islets, while deletion of either gene alone has limited effects, suggests functional compensation between these transporters . This has led to the hypothesis that ZnT8 may affect T2D susceptibility through actions in tissues where it is expressed at low levels rather than through direct effects on pancreatic islet function . These findings highlight the importance of considering zinc transporters as potential therapeutic targets or biomarkers in diabetes management strategies.

How does Slc30a7 influence cell survival and apoptotic pathways?

Slc30a7 has emerged as an important regulator of cell survival and apoptotic pathways in various cellular contexts. Research has demonstrated that ZnT7 can exert significant anti-apoptotic effects, particularly under conditions of cellular stress such as high glucose exposure. In rat peritoneal mesothelial cells (RPMCs), overexpression of ZnT7 results in decreased expression of pro-apoptotic factors including caspase 3, caspase 8, BAX, and AIF, correlating with enhanced cell survival in the presence of high glucose . Conversely, siRNA-mediated knockdown of ZnT7 expression leads to increased levels of apoptosis, further supporting its protective role against cell death . These findings suggest that ZnT7 functions as an important cellular defense mechanism against apoptotic stimuli, likely through its ability to maintain appropriate zinc homeostasis in critical subcellular compartments.

The molecular mechanisms underlying ZnT7's anti-apoptotic effects involve activation of the PI3K/Akt signaling pathway, a well-established pro-survival pathway in many cell types. Overexpression of ZnT7 is accompanied by activation of this pathway, which contributes to the inhibition of high glucose-induced apoptosis . This link to PI3K/Akt signaling provides a mechanistic explanation for how alterations in zinc transport and homeostasis can influence complex cellular processes like apoptosis. Additionally, the protective effects of ZnT7 against apoptosis may have important implications for understanding the pathophysiology of diseases characterized by enhanced cell death, such as diabetic complications affecting various tissues. These insights suggest that targeting ZnT7 expression or function could potentially offer therapeutic benefits in conditions where accelerated apoptosis contributes to tissue damage and dysfunction.

What evidence links Slc30a7 dysfunction to developmental abnormalities?

What are the optimal conditions for expressing and purifying recombinant rat Slc30a7?

The successful expression and purification of recombinant rat Slc30a7 requires careful optimization of multiple experimental parameters to ensure proper protein folding and function. For mammalian expression systems, HEK293T cells have been successfully used for overexpression of SLC30A7, as evidenced by western blot analysis comparing control vector-only transfected lysates with SLC30A7 overexpression lysates . When designing expression constructs, inclusion of a C-terminal tag such as myc-DDK (approximately 3.1 kDa) can facilitate detection and purification without significantly interfering with protein function . For efficient expression, codon optimization for the host expression system should be considered, particularly when expressing rat Slc30a7 in non-rodent expression systems.

Purification of membrane proteins like Slc30a7 presents particular challenges due to their hydrophobic nature and requirement for detergents to maintain solubility and native conformation. Based on approaches used for similar zinc transporters, a multi-step purification protocol typically involves membrane fraction isolation followed by solubilization using mild detergents like n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG). Immobilized metal affinity chromatography (IMAC) using nickel or cobalt resins can be employed for initial capture if the construct contains a polyhistidine tag, followed by size exclusion chromatography to improve purity and remove protein aggregates. Throughout the purification process, it's critical to maintain appropriate zinc concentrations in all buffers, as zinc is essential for the stability and proper folding of Slc30a7. Additionally, inclusion of zinc chelators like EDTA should be avoided in purification buffers, as they may strip zinc from the transporter and potentially lead to protein destabilization or functional impairment.

How can researchers accurately measure Slc30a7 transport activity in experimental systems?

Measuring the transport activity of Slc30a7 requires specialized assays that can detect zinc movement across membranes in a quantitative manner. One effective approach involves using zinc-specific fluorescent probes such as FluoZin-3 or Zinpyr-1, which can detect changes in free zinc concentrations in different cellular compartments. When designing these experiments, researchers should create systems where Slc30a7 is expressed in a controlled manner, such as in vesicle preparations or in cell lines with minimal endogenous zinc transporter expression. Transport activity can be measured by monitoring zinc uptake into vesicles containing recombinant Slc30a7 or by tracking changes in compartmental zinc levels in response to external zinc challenges in cells expressing Slc30a7.

Another important consideration for measuring Slc30a7 transport activity is accounting for its mechanism as a putative Zn²⁺/H⁺ antiporter. This suggests that transport assays should include controls for pH gradients across membranes, as these gradients may drive zinc transport . Researchers can employ pH-sensitive dyes alongside zinc indicators to simultaneously monitor changes in both zinc and pH during transport assays. For more precise kinetic measurements, radioisotope-based transport assays using ⁶⁵Zn can provide quantitative data on transport rates and affinity. When interpreting results from transport assays, it's essential to distinguish between transport mediated specifically by Slc30a7 versus that mediated by other endogenous transporters. This can be achieved by using specific inhibitors, if available, or by comparing transport in matched cell lines differing only in Slc30a7 expression. Importantly, transport activity measurements should be performed under physiologically relevant zinc concentrations to accurately reflect the function of Slc30a7 in vivo.

What controls and validations are essential when working with Slc30a7 antibodies?

Working with Slc30a7 antibodies requires rigorous controls and validations to ensure specificity and reliability of experimental results. When selecting antibodies for Slc30a7 detection, researchers should prioritize those that have been validated in multiple applications such as Western blotting, immunocytochemistry, and immunohistochemistry with appropriate positive and negative controls . Essential positive controls include lysates from cells overexpressing Slc30a7, which can be compared directly with vector-only transfected control lysates to confirm specificity . Negative controls should include samples from Slc30a7 knockout models or cells where Slc30a7 expression has been silenced using siRNA or CRISPR-Cas9 techniques.

For immunocytochemistry and immunohistochemistry applications, several additional validations are crucial. Researchers should confirm that the observed staining pattern matches the expected subcellular localization of Slc30a7, which is predominantly in the Golgi apparatus . Co-localization studies with established Golgi markers provide additional validation of antibody specificity. When performing tissue immunohistochemistry, comparison across multiple tissue types known to either express or not express Slc30a7 helps confirm antibody specificity. Pre-absorption controls, where the antibody is pre-incubated with excess recombinant Slc30a7 antigen before staining, should eliminate specific staining if the antibody is truly specific. Additionally, researchers should be aware that commercially available antibodies for research applications may not be approved for clinical diagnosis , which is an important consideration when planning translational studies. Finally, using multiple antibodies targeting different epitopes of Slc30a7 can provide further confidence in experimental results by confirming consistent patterns across different antibody reagents.

How are advanced imaging techniques enhancing our understanding of Slc30a7 localization and trafficking?

Advanced imaging techniques are revolutionizing our understanding of Slc30a7 localization, trafficking, and function within cellular compartments. Super-resolution microscopy techniques such as stimulated emission depletion (STED) microscopy, structured illumination microscopy (SIM), and stochastic optical reconstruction microscopy (STORM) now allow visualization of Slc30a7 distribution with nanometer-scale resolution, revealing details of its organization within the Golgi apparatus that were previously inaccessible with conventional confocal microscopy. These techniques have confirmed the predominant Golgi localization of ZnT7 while also detecting subpopulations in transport vesicles and specialized membrane domains . When combined with live-cell imaging approaches, these methods enable real-time tracking of Slc30a7 trafficking between compartments in response to changing zinc levels or cellular stimuli.

Correlative light and electron microscopy (CLEM) represents another powerful approach for studying Slc30a7 localization by combining the molecular specificity of fluorescence microscopy with the ultrastructural detail of electron microscopy. This technique allows researchers to precisely localize Slc30a7 within the complex architecture of the Golgi apparatus and other organelles. Additionally, proximity labeling methods like BioID or APEX2, which tag proteins in close proximity to a protein of interest, are being applied to identify the interactome of Slc30a7 within specific subcellular compartments. These approaches are revealing novel protein interactions that may regulate Slc30a7 trafficking or function. When designing imaging experiments for Slc30a7, researchers should carefully consider fixation methods, as some may disrupt the native distribution of membrane proteins. Live-cell imaging with fluorescently tagged Slc30a7 constructs offers advantages for tracking dynamic behaviors, although validation is necessary to ensure that the fluorescent tag does not interfere with normal protein localization or function.

What computational approaches are valuable for predicting Slc30a7 functional properties?

Computational approaches are increasingly valuable for predicting functional properties of Slc30a7 and guiding experimental research. Molecular dynamics simulations based on the recently solved cryo-EM structures of human ZnT7 in both zinc-bound and unbound states provide detailed insights into the conformational changes associated with the transport cycle . These simulations can predict how specific mutations might affect zinc binding, protein stability, or the conformational changes required for transport. Additionally, homology modeling approaches using the human ZnT7 structure as a template can generate structural models of rat Slc30a7, allowing researchers to identify conserved and divergent features that might influence function or drug interactions across species.

Machine learning approaches represent another powerful computational tool for Slc30a7 research. By integrating data from multiple sources—including expression profiles, protein-protein interactions, and phenotypic outcomes from knockout models—these methods can generate testable hypotheses about Slc30a7 function in different cellular contexts. For instance, analysis of gene co-expression networks can identify genes whose expression patterns correlate with Slc30a7 across different tissues or disease states, suggesting functional relationships. Virtual screening and molecular docking methods can identify potential small molecule modulators of Slc30a7 activity, which could serve as experimental tools or starting points for therapeutic development. When implementing computational approaches, researchers should carefully validate predictions with experimental data, as the accuracy of computational models depends on the quality and completeness of the underlying data. Integrating results from multiple computational methods with different underlying assumptions can increase confidence in predictions and highlight areas of consensus that may be particularly promising for experimental follow-up.

How might CRISPR-based approaches advance Slc30a7 functional studies?

CRISPR-Cas9 and related genome editing technologies offer unprecedented opportunities to advance functional studies of Slc30a7 with greater precision and efficiency than traditional methods. CRISPR-based knockout approaches enable rapid generation of Slc30a7-deficient cell lines for in vitro studies, avoiding the time and resources required for developing knockout mouse models. These cell-based models can be particularly valuable for high-throughput screening applications to identify factors that modify Slc30a7 function or compensate for its loss. Moreover, CRISPR knock-in strategies allow introduction of specific mutations or tags at the endogenous Slc30a7 locus, ensuring physiological expression levels and regulatory control while enabling detailed functional or localization studies.

Beyond simple gene disruption or modification, CRISPR-based approaches offer sophisticated tools for dissecting Slc30a7 regulation and function. CRISPR interference (CRISPRi) and CRISPR activation (CRISPRa) technologies enable precise modulation of Slc30a7 expression without altering the gene sequence, allowing researchers to study dose-dependent effects of Slc30a7 expression on cellular phenotypes. CRISPR-based base editing and prime editing technologies permit introduction of specific nucleotide changes without requiring double-strand breaks, facilitating the study of specific Slc30a7 variants identified in human populations or disease states. Additionally, CRISPR screening approaches using libraries of guide RNAs targeting genes throughout the genome can identify genetic interactions with Slc30a7, revealing pathways that enhance or suppress phenotypes associated with Slc30a7 dysfunction. When designing CRISPR-based experiments, researchers should carefully consider potential off-target effects and implement appropriate controls, including rescue experiments with wild-type Slc30a7 to confirm the specificity of observed phenotypes. The combination of CRISPR technologies with advanced imaging, proteomics, or metabolomics approaches creates powerful platforms for comprehensive functional characterization of Slc30a7 in diverse biological contexts.

What potential therapeutic applications could target Slc30a7 function in metabolic disorders?

The emerging understanding of Slc30a7's role in glucose metabolism and cell survival suggests several potential therapeutic applications targeting this transporter in metabolic disorders. Given that ZnT7 plays a role in pancreatic islet function and that its deletion impairs glucose tolerance and reduces pancreatic insulin content , enhancing ZnT7 function could potentially improve β-cell function in diabetes. Small molecule activators of ZnT7 transport activity could increase zinc availability in secretory pathway organelles, potentially enhancing insulin processing and secretion. Additionally, the protective effects of ZnT7 against apoptosis through activation of the PI3K/Akt pathway suggest that targeting ZnT7 could help prevent β-cell loss in diabetes or reduce cellular damage in diabetic complications affecting various tissues.

How do interspecies differences in Slc30a7 impact translational research?

Interspecies differences in Slc30a7 structure, expression, and function present important considerations for translational research using animal models. While the Slc30a7 gene is highly conserved across mammalian species, subtle differences in amino acid sequence, post-translational modifications, or regulatory elements may influence its functional properties or interactions with other proteins. Researchers using rat Slc30a7 as a model should be aware that findings may not translate directly to human applications without appropriate validation. Comparative analysis of rat and human Slc30a7 sequences and functional properties can help identify conserved domains that likely serve similar functions across species, as well as divergent regions that might contribute to species-specific differences in zinc transport kinetics or regulation.

Beyond sequence-level differences, species variations in Slc30a7 expression patterns and relative abundance compared to other zinc transporters may impact the translational relevance of findings. For instance, the relative expression levels of Slc30a7 and Slc30a8 in pancreatic islets may differ between rodents and humans, potentially affecting the compensatory dynamics between these transporters in different species . Additionally, metabolic regulation and glucose homeostasis mechanisms show important differences between rodents and humans, which may influence how alterations in Slc30a7 function manifest phenotypically across species. When designing translational studies, researchers should consider employing multiple model systems, including human cell lines or primary cells alongside rodent models, to assess whether findings are conserved across species. Humanized mouse models expressing human SLC30A7 in place of the endogenous mouse gene may also provide valuable tools for enhancing the translational relevance of preclinical studies, particularly when testing therapeutic agents targeting this transporter.

What are the most promising future research directions for Slc30a7 investigation?

Several promising research directions are emerging that could significantly advance our understanding of Slc30a7 biology and its therapeutic potential. One key area is the detailed characterization of Slc30a7 regulation under physiological and pathological conditions. While some studies have identified glucose as a regulator of Slc30a7 expression , a comprehensive understanding of the transcriptional, post-transcriptional, and post-translational mechanisms controlling Slc30a7 levels and activity remains to be established. Investigation of these regulatory mechanisms could reveal new approaches for modulating Slc30a7 function in disease contexts and identify biomarkers for altered Slc30a7 activity in patients.

Another promising direction involves the exploration of tissue-specific functions of Slc30a7 beyond pancreatic islets. While much research has focused on Slc30a7's role in β-cells and glucose homeostasis , its expression in other tissues suggests broader physiological functions that remain to be fully characterized. Tissue-specific conditional knockout models could help define these functions while avoiding the potential developmental effects of global Slc30a7 deletion. Additionally, the recent structural insights into human ZnT7 provide a foundation for structure-based drug design targeting specific functional aspects of this transporter. High-throughput screening approaches combined with structural biology could identify small molecules that modulate Slc30a7 activity for research or therapeutic applications.

The integration of multi-omics approaches represents another exciting frontier for Slc30a7 research. Combining transcriptomics, proteomics, metabolomics, and functional genomics in Slc30a7-modified systems could provide comprehensive insights into the cellular consequences of altered Slc30a7 function and identify key molecular pathways that mediate its effects. These approaches might be particularly valuable for understanding the systemic impact of Slc30a7 dysfunction in complex metabolic disorders. Finally, investigation of potential linkages between Slc30a7 and other diseases beyond diabetes, particularly those associated with disrupted zinc homeostasis or secretory pathway function, could expand the therapeutic relevance of this important zinc transporter and reveal new applications for modulators of its activity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.