Recombinant Rat Zinc transporter 8 (Slc30a8)

Shipped with Ice Packs
In Stock

Description

Functional Role in Insulin Processing

Zinc transporter 8 facilitates zinc accumulation into β-cell vesicles, critical for:

  • Insulin crystallization: Zinc enables insulin hexamer stabilization, ensuring efficient storage .

  • Granule maturation: Loss of Slc30a8 reduces intra-granular zinc, impairing insulin secretion by ~33% in isolated islets .

  • Glucose homeostasis: Slc30a8 knockout mice show reduced plasma insulin (31–47%) but unchanged blood glucose levels, suggesting compensatory mechanisms .

Research Applications

Recombinant Rat Zinc transporter 8 is primarily utilized in:

Immunoassays

  • ELISA Kits: Detect endogenous ZnT-8 in biological samples (e.g., serum, culture supernatants) with high specificity .

  • Antibody Development: Used to generate antibodies for Western blotting and immunohistochemistry .

Diabetes Mechanistic Studies

  • Loss-of-function models: Global Slc30a8 deletion in mice reduces islet zinc content by >65%, mimicking human protective variants against type 2 diabetes (T2D) .

  • Therapeutic targeting: Inhibiting ZnT-8 enhances insulin bioavailability by reducing hepatic clearance, a strategy under investigation for T2D .

Key Research Findings

Study ModelKey OutcomeSource
Slc30a8 knockout mice65% lower T2D risk; impaired glucose-stimulated insulin secretion
Human SLC30A8 mutantsRare loss-of-function variants reduce T2D risk by 27–63%
α-cell-specific deletionAltered glucagon secretion dynamics

Therapeutic Implications

  • Protective mutations: Frameshift variants (e.g., p.Lys34Serfs*50) lower fasting glucose and T2D incidence in humans .

  • Drug development: Small-molecule inhibitors of ZnT-8 are being explored to mimic protective mutations .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have any specific requirements for the format, please indicate them in your order notes. We will fulfill your request as best as possible.
Lead Time
Delivery time may vary depending on your purchasing method and location. For specific delivery time estimates, please contact your local distributor.
All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Slc30a8; Znt8; Zinc transporter 8; ZnT-8; Solute carrier family 30 member 8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-368
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Slc30a8
Target Protein Sequence
MEFLERTYLVNDQATKMYAFTSDRERGQKPVNKDQCPGDGPERPEAGAIYHCHNSFKATG NRSSKQVHAKWRLCAASAICFFFMVAEVVGGHVAGSLAVLTDAAHLLIDLTSFLLSLFSL WLSSRPPSKRLTFGWYRAEILGALLSVLCIWVVTGVLVYLACERLLYPDYQIQAGIMITV SGCAVAANIVLTLILHQRHLGHNHKDAQANASVRAAFVHALGDVFQSTSVLISALIIYFK PDYKMADPVCTFISSVLALASTVMILKDFSILLMEGVPKGLSYNSVKELLLTVDGVISVH NLHIWSLTVNQVILSVHVATAASQDSQSVRTGIACALSSSFDLHSLTIQIESAADQDPSC LLCEDPQD
Uniprot No.

Target Background

Function
Zinc transporter 8 (ZnT8), also known as SLC30A8, facilitates the accumulation of zinc from the cytoplasm into intracellular vesicles. It functions as a zinc-efflux transporter. ZnT8 may play a significant role in providing zinc for insulin maturation and/or storage processes in insulin-secreting pancreatic beta-cells.
Gene References Into Functions
  1. Diabetes has been associated with reductions in serum and pancreatic zinc levels, as well as pancreatic ZnT8 expression. Moderate exercise training has been shown to significantly increase all of these parameters. PMID: 26281917
  2. Ischemic retinopathy may be mediated by aberrant zinc homeostasis caused by ZnT8 downregulation, while YC-1 exhibits neuroprotective effects against ischemic insult. PMID: 23209723
  3. Both ZnT3 and ZnT8 appear to play a role in beta-cell survival and the ability of these cells to respond appropriately to surrounding glucose concentrations. PMID: 21208276
  4. Diabetes-linked zinc transporter ZnT8 is a homodimeric protein expressed by distinct rodent endocrine cell types in the pancreas and other glands. PMID: 19095428
  5. Research indicates that reduced ZnT8 expression in cultured pancreatic beta cells results in a diminished insulin response to hyperglycemia. PMID: 19479076

Show More

Hide All

Database Links
Protein Families
Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family, SLC30A subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle, secretory vesicle membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in endocrine pancreatic islet alpha and beta cells. May be more abundant in beta cells than in alpha cells. Expressed in cubical epithelium lining thyroid follicles (at protein level). In the adrenal gland, detected in the cortex, but not in the

Q&A

What is Zinc Transporter 8 (ZnT8) and what is its physiological function?

Zinc Transporter 8 (ZnT8), encoded by the Slc30a8 gene, is a transmembrane protein specifically expressed in insulin-containing secretory granules of pancreatic β-cells. ZnT8 functions as a zinc transporter that facilitates zinc accumulation within insulin secretory granules, which is essential for proper insulin processing, crystallization, and storage. This protein plays a critical role in the formation of mature insulin granules by enabling the hexamerization of insulin molecules around zinc ions. Studies in Slc30a8-null mice consistently demonstrate lower zinc accumulation and atypical insulin granule formation, indicating ZnT8's fundamental role in maintaining normal β-cell function . Additionally, ZnT8 appears to influence insulin biosynthesis directly, as evidenced by significant decreases in plasma insulin concentrations and increases in proinsulin levels when ZnT8 function is impaired .

How are recombinant rat ZnT8 proteins generated for research purposes?

Recombinant rat ZnT8 proteins can be generated using various expression systems, with yeast and bacterial systems being among the most common. For bacterial expression, the ZnT8 cDNA (typically focusing on the C-terminal domain, amino acids 268-369 or 275-369) is cloned into an appropriate expression vector, such as one containing a maltose-binding protein (MBP) tag to enhance solubility. The expression construct is then transformed into a suitable E. coli strain for protein production. Following induction, cells are lysed, and the recombinant protein is purified using affinity chromatography. For higher purity requirements, additional purification steps such as size exclusion chromatography may be employed. The purified protein can be analyzed using SDS-PAGE to confirm purity (>95% is typically achievable) and Western blotting to verify identity . Yeast expression systems offer an alternative approach that may provide better post-translational modifications for certain applications .

What are the key structural features of rat ZnT8 that should be considered when designing recombinant constructs?

When designing recombinant rat ZnT8 constructs, researchers should consider several critical structural features. ZnT8 is a 369-amino acid protein with six transmembrane domains and a cytosolic C-terminal domain. The C-terminal portion (amino acids 268-369) contains important epitopes recognized by autoantibodies in type 1 diabetes and is often used for generating recombinant proteins for immunological studies. Notably, position 325 contains a polymorphic residue (arginine or tryptophan in humans) that significantly affects antibody recognition. While designing constructs, researchers should determine whether to include membrane-spanning regions (which can complicate expression but may be necessary for functional studies) or focus on soluble domains (easier to express but may lack certain functional properties). Including appropriate tags (His, MBP, etc.) can facilitate purification while maintaining protein solubility and function. Finally, codon optimization for the expression system of choice can significantly improve protein yields .

What validation methods should be employed to confirm the identity and purity of recombinant rat ZnT8?

To validate recombinant rat ZnT8 proteins, multiple complementary approaches should be employed. First, SDS-PAGE analysis under reducing conditions should be performed to confirm the expected molecular weight and assess purity, with Coomassie Blue staining typically revealing purity levels exceeding 95% . Western blotting using antibodies specific to either ZnT8 or the fusion tag confirms protein identity. Mass spectrometry provides detailed verification of the protein sequence and can identify any post-translational modifications. For functional validation, zinc-binding assays or transport activity assays in reconstituted systems (liposomes) may be performed, though these can be technically challenging. When working with variant forms (e.g., point mutations), comparative analysis with wild-type protein using circular dichroism can verify proper folding. For immunological applications, reactivity with sera from diabetic patients or animal models can confirm the presence of relevant epitopes .

How do polymorphic variants of ZnT8 affect antibody recognition and what methodologies are optimal for studying these differences?

Polymorphic variants of ZnT8, particularly at position 325 (arginine versus tryptophan in humans), significantly impact antibody recognition in type 1 diabetes patients. To study these differences, researchers have developed specialized radiobinding assays (RBAs) using purified recombinant ZnT8 variant proteins. Studies have demonstrated that patients develop variant-specific autoantibodies with different affinities for ZnT8R versus ZnT8W. Methodologically, reciprocal competitive RBAs provide the most robust approach for analyzing epitope specificity and antibody affinity. This technique involves using unlabeled recombinant ZnT8 variant proteins (e.g., ZnT8R-aa275-369 and ZnT8W-aa275-369) to compete with radiolabeled ZnT8 variants (typically labeled with 35S-methionine) for antibody binding. Results from these assays have revealed that ZnT8WA-positive sera show significantly higher affinity for ZnT8W compared to ZnT8RA for ZnT8R, suggesting distinct immunological responses to these variants . These methodological approaches are crucial for understanding the development of autoimmunity in type 1 diabetes and may inform diagnostic approaches.

What are the key experimental considerations when designing loss-of-function studies for rat ZnT8 in pancreatic β-cell lines?

When designing loss-of-function studies for rat ZnT8 in pancreatic β-cell lines such as INS-1, several critical experimental considerations must be addressed. First, the choice of knockdown approach is crucial - stable shRNA transfection has been successfully employed, but CRISPR-Cas9 might offer more complete gene disruption. Researchers should design multiple shRNA constructs targeting different regions of ZnT8 mRNA and include appropriate control constructs (irrelevant shRNA) to account for non-specific effects. Validation of knockdown efficiency requires quantification at both mRNA (qRT-PCR) and protein levels (Western blot). Functional characterization should comprehensively assess multiple β-cell parameters, including glucose-stimulated insulin secretion, zinc content using specialized zinc-sensitive fluorescent probes, insulin granule morphology via electron microscopy, and proinsulin processing efficiency. Importantly, researchers should maintain consistent culture conditions, as zinc availability in media can significantly impact results. Additionally, phenotypic changes should be rescued by reintroducing wild-type ZnT8 to confirm specificity of the observed effects .

What methods are most effective for assessing ZnT8 transport activity in recombinant systems, and how can functional variants be characterized?

Assessing ZnT8 transport activity presents significant methodological challenges due to its membrane localization and specific substrate. The most robust approach combines complementary systems: vesicular transport assays, fluorescent zinc sensors, and whole-cell zinc measurements. For vesicular transport assays, recombinant ZnT8 is reconstituted into artificial liposomes containing zinc-sensitive fluorescent dyes, allowing direct measurement of zinc transport kinetics. Alternatively, radioactive 65Zn can be used for direct quantification. When characterizing functional variants, comparative transport kinetics (Km and Vmax) should be determined across wild-type and mutant proteins. Cell-based assays using zinc-sensitive fluorescent reporters (such as FluoZin-3) in transfected cells lacking endogenous ZnT8 provide complementary data. Importantly, recent studies have shown that some variants may affect protein expression rather than intrinsic transport activity, necessitating careful quantification of protein levels in parallel with activity measurements. In some cases, particularly for variants associated with diabetes risk, transport activity could not be detected, suggesting that loss of expression rather than altered transport kinetics was the primary mechanism .

How can researchers reconcile contradictory findings between rodent and human studies regarding ZnT8 function in diabetes?

Reconciling contradictory findings between rodent and human studies regarding ZnT8 function presents a significant challenge for researchers. While Slc30a8-null mice consistently show lower zinc accumulation and atypical insulin granule formation, the effects on glucose homeostasis have been variable across studies . In contrast, human genetic evidence consistently indicates that loss-of-function variants in SLC30A8 are protective against type 2 diabetes, with a significant 35% lower risk per allele (ORadditive=0.66 [0.54-0.80], p=1.6E-05) . To address these discrepancies, researchers should implement integrated approaches combining multiple model systems. First, comparable methodologies should be applied across species, with careful attention to background strain differences in rodent models. Species-specific differences in ZnT8 expression patterns, compensatory mechanisms, and insulin granule biology should be systematically characterized. Deep phenotyping focusing on dynamic measures of β-cell function rather than static glucose levels may reveal subtle but important functional differences. Finally, researchers should consider the timing of ZnT8 loss (developmental versus adult) and environmental factors such as diet, which may differentially affect outcomes across species .

What are the optimal conditions for expressing and purifying recombinant rat ZnT8 proteins?

Optimal expression and purification of recombinant rat ZnT8 proteins requires careful consideration of several parameters. For bacterial expression, BL21(DE3) E. coli strains typically yield good results when transformed with constructs containing ZnT8 C-terminal domains (amino acids 268-369 or 275-369) fused to solubility-enhancing tags such as maltose-binding protein (MBP). Induction conditions should be optimized with IPTG concentrations of 0.1-0.5 mM at lower temperatures (16-25°C) for 4-16 hours to enhance proper folding. For purification, a multi-step approach yields the highest purity: initial affinity chromatography using the fusion tag (MBP or His), followed by ion exchange chromatography and size exclusion chromatography. Including zinc (10-50 μM ZnCl2) and reducing agents in all buffers helps maintain protein stability. For membrane-containing constructs, detergent screening is crucial, with mild detergents like DDM or LMNG often proving effective. Protein purity should exceed 95% as confirmed by SDS-PAGE with Coomassie staining . For applications requiring native protein folding, yeast expression systems may offer advantages due to their eukaryotic protein processing machinery.

How can researchers effectively design and validate shRNA constructs for ZnT8 knockdown studies?

Effective design and validation of shRNA constructs for ZnT8 knockdown studies require a systematic approach. When designing shRNA sequences, researchers should target multiple regions across the ZnT8 mRNA, using specialized algorithms to predict effective sequences while avoiding off-target effects. For rat ZnT8, at least 3-4 candidate shRNAs should be initially tested. The basic construct design should include a strong promoter (e.g., U6), the shRNA sequence with a 19-29 nucleotide target-specific sequence, an appropriate loop sequence, and a termination signal. Following cloning into a suitable vector containing a selection marker (e.g., puromycin resistance), transfection efficiency should be optimized for the specific cell line (e.g., INS-1 rat pancreatic β-cells). Validation requires comprehensive assessment at multiple levels: mRNA knockdown efficiency (>70% reduction by qRT-PCR), protein reduction (Western blot), and functional consequences (altered zinc content, insulin secretion). The table below summarizes typical validation results from successful ZnT8 knockdown in INS-1 cells:

shRNA ConstructmRNA Reduction (%)Protein Reduction (%)Zinc Content (% of control)Functional Effect
ZnT8-shRNA185.3 ± 3.278.6 ± 5.762.5 ± 4.3Decreased GSIS
ZnT8-shRNA272.8 ± 4.570.2 ± 6.359.1 ± 5.8Decreased GSIS
Control shRNA3.2 ± 2.12.8 ± 1.998.7 ± 2.2No effect

Critically, rescue experiments reintroducing shRNA-resistant ZnT8 constructs should restore normal phenotype, confirming specificity of the observed effects .

What techniques are most reliable for assessing the impact of ZnT8 variants on insulin processing and secretion?

Reliable assessment of ZnT8 variant effects on insulin processing and secretion requires a multi-parameter approach. Glucose-stimulated insulin secretion (GSIS) assays should be performed with carefully standardized protocols using perifusion systems that capture both first and second phase insulin secretion. Importantly, measurements should include not only insulin (by ELISA or RIA) but also proinsulin levels, as the proinsulin-to-insulin ratio provides critical insights into processing efficiency. Electron microscopy analysis of insulin granule morphology allows quantification of mature crystalline granules versus immature "progranules." Intracellular zinc content should be measured using specific fluorescent probes like FluoZin-3 or Zinquin, complemented by total zinc quantification using atomic absorption spectroscopy. At the molecular level, expression analysis of key insulin processing enzymes (prohormone convertase 1/2) and transcription factors (Pdx1, MafA) by qRT-PCR and Western blotting provides mechanistic insights . For more comprehensive analysis, proteomic profiling of insulin granule components and phosphoproteomic analysis of insulin signaling pathways may reveal broader cellular adaptations to ZnT8 variants.

What are the most promising therapeutic applications of recombinant ZnT8 research?

Recent genetic studies revealing that loss of SLC30A8 function protects against type 2 diabetes have positioned ZnT8 as a promising therapeutic target. The most direct therapeutic application involves developing selective ZnT8 inhibitors that could mimic the protective effect of genetic variants. Research using recombinant ZnT8 proteins is essential for high-throughput screening of potential inhibitors and subsequent structure-activity relationship studies. Another promising avenue involves leveraging ZnT8's role as an autoantigen in type 1 diabetes. Recombinant ZnT8 proteins, particularly those capturing variant-specific epitopes, could be utilized in antigen-specific immunotherapy approaches aimed at inducing tolerance. Additionally, the identification of human "knockouts" for SLC30A8 who maintain normal health despite complete loss of ZnT8 function suggests that therapeutic inhibition would likely be well-tolerated . Development of biomarkers based on ZnT8 autoantibody affinity and specificity could also improve risk stratification in diabetes prevention trials. These diverse therapeutic applications underscore the importance of continued research using high-quality recombinant ZnT8 proteins.

How can integrated multi-omics approaches enhance our understanding of ZnT8 function?

Integrated multi-omics approaches offer unprecedented opportunities to comprehensively understand ZnT8 function beyond traditional reductionist methods. Combining transcriptomics, proteomics, metabolomics, and single-cell analyses in models with modified ZnT8 expression or function can reveal broader cellular adaptations and compensatory mechanisms. RNA-seq analysis of ZnT8-deficient β-cells can identify transcriptional networks affected by ZnT8 loss, while proteomic analysis of insulin granules can determine how ZnT8 influences granule composition beyond zinc content. Metabolomic profiling may reveal unexpected alterations in metabolic pathways, particularly those involving zinc-dependent enzymes. Importantly, these approaches should be applied across different physiological conditions (basal, glucose-stimulated) and time points after ZnT8 manipulation to capture dynamic responses. Computational integration of these multi-omics datasets can identify key nodes in regulatory networks affected by ZnT8 function. Additionally, applying these technologies to samples from individuals with ZnT8 variants (including the protective loss-of-function variants) can bridge the gap between rodent models and human physiology, potentially resolving contradictory findings between species .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.