Recombinant Rat Zinc transporter ZIP11 (Slc39a11)

Shipped with Ice Packs
In Stock

Description

Production of Recombinant Rat ZIP11

Recombinant Rat ZIP11 is synthesized using E. coli expression systems, ensuring high purity (>90%) and stability .

ParameterDetails
Expression SystemE. coli
TagHis/GST (varies by product)
Amino Acid Range1-335 (full-length) or partial sequences (e.g., 93-193AA)
Molecular Weight~68 kDa (observed); 35.4 kDa (calculated)
StorageTris/PBS buffer with 50% glycerol; stable at -80°C

Zinc Homeostasis

  • ZIP11 is highly expressed in the stomach and colon, where it localizes to nuclei and cytoplasm .

  • Dietary Regulation: Colonic ZIP11 expression increases during zinc restriction, enhancing absorption efficiency .

Cancer Relevance

  • In HeLa cells, ZIP11 knockdown causes nuclear zinc accumulation, impairing proliferation, migration, and mitochondrial function .

  • Overexpression correlates with aggressive cancer phenotypes, suggesting therapeutic targeting potential .

Applications in Research

Recombinant ZIP11 is utilized in:

  • ELISA/Western Blot: Detecting endogenous ZIP11 levels using antibodies like PACO39902 .

  • Functional Studies: Investigating zinc transport kinetics via isotopic tracing or fluorescence assays .

  • Disease Modeling: Linking ZIP11 dysregulation to cancers and metabolic disorders .

Key Research Findings

  • Nuclear Zinc Regulation: ZIP11 is the only ZIP transporter localized to mammalian nuclei, critical for gene expression and cell cycle progression .

  • Metal Response Elements: ZIP11’s promoter contains MREs, enabling transcriptional regulation by zinc levels .

Future Directions

Current research focuses on ZIP11’s role in cancer metastasis and its potential as a biomarker. Studies using recombinant ZIP11 could clarify its interaction with nuclear zinc-binding proteins and therapeutic inhibitors .

Product Specs

Form
Supplied as a lyophilized powder.

Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for guaranteed fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.

Note: Standard shipping includes blue ice packs. Dry ice shipping is available upon request, but incurs additional charges. Please contact us in advance.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.

If a specific tag type is required, please inform us, and we will prioritize its implementation.
Synonyms
Slc39a11; Zip11; Zinc transporter ZIP11; Solute carrier family 39 member 11; Zrt- and Irt-like protein 11; ZIP-11
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-335
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Slc39a11
Target Protein Sequence
MLQGYSSVSQALLGTFFTWAMTAAGAALVFIFSSGQRRILDGSLGFAAGVMLAASYWSLL APAVEMATSSGGFGAFAFFPVAVGFTLGAAFVYLADLLMPHLGAGEDPQTALALNLDPAL VKKSDLKDPASLLFPERELSIRIDKRENGEVYQRKKLAATDFPEGAAPSGPVHGNSGQPG VSSWRRIALLILAITIHNIPEGLAVGVGFGAVEKTASATFESARNLAIGIGIQNFPEGLA VSLPLRGAGFSTWKAFWYGQLSGMVEPLAGVFGAFAVVLAEPVLPYALAFAAGAMVYVVM DDIIPEAQISGNGKLASWASILGFVVMMSLDVGLG
Uniprot No.

Target Background

Function
Functions as a cellular zinc transporter.
Database Links
Protein Families
ZIP transporter (TC 2.A.5) family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Nucleus. Cytoplasm. Golgi apparatus.

Q&A

What is the evolutionary significance of ZIP11 among zinc transporters?

ZIP11 (SLC39A11) stands as the sole member of the gufA subfamily of ZIP transporters, making it evolutionarily distinct from other zinc transporters . The protein is remarkably well-conserved across multiple species, suggesting its fundamental importance in zinc metabolism throughout evolutionary history . In mice, ZIP11 is encoded on the antisense strand of chromosome 11, while human ZIP11 is located on the antisense strand of chromosome 17, demonstrating conservation of genomic organization despite evolutionary divergence . For researchers investigating evolutionary aspects, comparative genomic approaches using multiple sequence alignments across species can reveal conserved domains that likely represent functionally critical regions. When conducting such analyses, it's essential to include both vertebrate and invertebrate species to fully capture the evolutionary trajectory of this transporter, as its conservation pattern may reveal insights into fundamental zinc homeostasis mechanisms that predate the vertebrate lineage.

How does the expression pattern of ZIP11 vary across different tissues?

ZIP11 demonstrates a distinctive tissue expression pattern with highest levels detected in the gastrointestinal tract, particularly in the stomach, cecum, and colon of mice . This expression pattern differs significantly from other ZIP family members, suggesting specialized functions in digestive tissues. When investigating tissue-specific expression in rat models, researchers should use quantitative PCR with validated reference genes specific to gastrointestinal tissues to avoid normalization errors that often plague cross-tissue comparisons. Immunohistochemical studies have revealed that ZIP11 is prominently localized to gastric parietal cells and lower regions of gastric glands, as well as throughout the crypts of colonic mucosa . For comprehensive tissue profiling, researchers should employ both transcriptomic and proteomic approaches, as post-transcriptional regulation may result in discrepancies between mRNA and protein levels across different tissues. Additionally, considering the nuclear localization observed in some cell types, subcellular fractionation studies should be incorporated into tissue expression analyses to fully characterize ZIP11's distribution patterns.

What is the subcellular localization of ZIP11 and how does it differ from other ZIP transporters?

Unlike most ZIP transporters that primarily localize to the plasma membrane, ZIP11 demonstrates a more complex subcellular distribution . In colonic cells, ZIP11 has been detected in cytoplasmic, membrane, and nuclear fractions, with particularly notable nuclear colocalization . This unique localization pattern suggests ZIP11 may regulate zinc distribution between cellular compartments rather than solely facilitating extracellular zinc uptake. For researchers investigating subcellular localization, immunofluorescence microscopy with Z-stack imaging is recommended to accurately visualize the three-dimensional distribution of ZIP11 within cells. Subcellular fractionation experiments should include positive controls for each fraction (e.g., TBP for nuclear, tubulin for cytoplasmic, and known membrane proteins like ZIP4 for membrane fractions) to validate the purity of isolated compartments . When designing localization studies, researchers should consider using both N-terminal and C-terminal tagged constructs, as the positioning of tags can sometimes interfere with proper localization signals, especially considering the unusual 3+2+3TM structure of ZIP transporters described in related family members .

What are the molecular mechanisms by which ZIP11 regulates nuclear zinc homeostasis?

Recent research has revealed that ZIP11 plays a crucial role in maintaining nuclear zinc homeostasis, particularly in rapidly dividing cells . In HeLa cells, knockdown of ZIP11 resulted in nuclear accumulation of zinc, suggesting that ZIP11 may function to export zinc from the nucleus or regulate its distribution between nuclear compartments . This zinc accumulation led to impaired cell proliferation, highlighting the importance of proper nuclear zinc homeostasis for cellular functions . The molecular mechanisms likely involve interaction with the zinc-sensing transcription machinery, including metal-responsive transcription factors. To investigate these mechanisms, researchers should employ fluorescent zinc sensors with nuclear localization signals to monitor real-time changes in nuclear zinc concentrations following ZIP11 manipulation. Chromatin immunoprecipitation sequencing (ChIP-seq) for zinc-dependent transcription factors like MTF1 would help identify genomic regions where transcription is altered due to nuclear zinc dysregulation. Additionally, proximity labeling techniques such as BioID or APEX2 fused to ZIP11 could identify protein interaction partners within the nuclear compartment, potentially revealing the molecular machinery through which ZIP11 regulates nuclear zinc levels.

How does ZIP11 function differ between normal and cancer cells?

ZIP11 appears to have significant roles in cancer progression, with high expression correlating with poor prognosis in cervical cancer, renal cell carcinoma, bladder cancer, and pancreatic adenocarcinoma patients . In HeLa cancer cells, ZIP11 knockdown resulted in reduced proliferation, impaired migration, decreased invasive properties, delayed cell cycle progression, and enhanced senescence . These effects were attributed to nuclear zinc accumulation and subsequent dysregulation of genes involved in angiogenesis, apoptosis, mRNA metabolism, and signaling pathways, particularly the Notch pathway . To investigate functional differences between normal and cancer cells, researchers should perform comparative studies using matched normal and cancer cell lines from the same tissue of origin. Transcriptomic profiling through RNA-seq analysis following ZIP11 modulation would help identify differentially affected pathways . Metabolic flux analysis would be valuable to assess whether ZIP11's impact on mitochondrial potential and cellular metabolism differs between normal and transformed cells. For researchers interested in translational aspects, correlation analyses between ZIP11 expression levels and patient outcomes across multiple cancer types could help prioritize cancer types where ZIP11 targeting might offer therapeutic benefit.

What are the optimal approaches for studying ZIP11 transport activity in vitro?

Studying the transport activity of ZIP11 requires careful experimental design due to its unique subcellular localization and potential metal specificities . Traditional metal uptake assays used for plasma membrane transporters may not fully capture ZIP11 function due to its presence in multiple cellular compartments. For direct transport measurements, researchers should consider using isolated organelles or membrane vesicles enriched for ZIP11, coupled with radioisotope or fluorescent zinc probes. For whole-cell studies, subcellular-targeted zinc sensors can help monitor compartment-specific zinc changes in response to ZIP11 manipulation. When expressing recombinant ZIP11, it's important to verify proper folding and localization, as overexpression systems may lead to mislocalization or formation of non-functional aggregates . Competition experiments with various metals (e.g., zinc, copper, iron) can help determine transport specificity, as some studies have suggested ZIP11 may also transport copper in addition to zinc . Kinetic analyses should include determination of apparent Km values for different metal ions and the effects of pH and other potential regulatory factors on transport activity.

What are the best methods for generating and validating ZIP11 knockout or knockdown models?

For effective ZIP11 loss-of-function studies, researchers can employ several complementary approaches, each with specific advantages and considerations . CRISPR-Cas9 genome editing provides complete gene knockout but may trigger compensatory mechanisms during development if ZIP11 is essential. Inducible shRNA systems, as used in studies with HeLa cells, offer temporal control over knockdown and have successfully demonstrated ZIP11's role in proliferation and nuclear zinc homeostasis . When designing knockdown experiments, researchers should target multiple regions of the ZIP11 transcript and validate knockdown efficiency at both mRNA (qPCR) and protein (Western blot) levels using validated antibodies . For validation of knockdown phenotypes, rescue experiments with shRNA-resistant ZIP11 constructs are essential to confirm specificity of observed effects . When studying potential zinc accumulation resulting from ZIP11 deficiency, researchers should employ multiple zinc detection methods, including zinc-specific fluorescent probes and inductively coupled plasma mass spectrometry (ICP-MS) for quantitative measurements in cellular fractions . Additionally, phenotypic validation should include comprehensive assessment of cellular processes affected by zinc dysregulation, including proliferation, migration, cell cycle progression, and senescence markers, as these have all been implicated in ZIP11 function .

What considerations are important when designing experiments to study ZIP11 in relation to zinc-dependent cellular processes?

When investigating ZIP11's role in zinc-dependent cellular processes, researchers must carefully control experimental zinc conditions and consider potential compensatory mechanisms . Culture media composition significantly impacts baseline zinc status, and researchers should standardize or explicitly state serum concentrations and sources, as these contribute variable amounts of zinc. For zinc supplementation or depletion experiments, dose-response and time-course studies are essential, as cellular responses may vary dramatically with concentration and duration of treatment . Researchers should include appropriate positive controls for zinc-responsive genes (e.g., metallothionein) to confirm the effectiveness of zinc manipulations, as done in studies examining ZIP11 regulation in mouse tissues . When examining zinc-dependent processes following ZIP11 manipulation, parallel assessment of other zinc transporters is recommended, as compensatory expression changes in transporters like ZIP14 have been observed . Additionally, researchers should consider the interdependence of zinc with other essential metals, particularly in experiments involving chelators like TPEN, which may affect multiple metal ions despite being marketed as zinc-specific. For experiments involving zinc-dependent transcription factors like MTF1, chromatin immunoprecipitation can determine direct regulation of target genes versus secondary effects mediated through altered zinc homeostasis .

How should researchers reconcile differences in ZIP11 function between cell types and model organisms?

ZIP11 function appears to vary significantly between different cell types and experimental models, requiring careful interpretation of comparative data . In mice, ZIP11 is highly expressed in gastrointestinal tissues and shows responsiveness to dietary zinc restriction in the stomach but not the colon . In contrast, human cancer cell studies reveal ZIP11's importance in nuclear zinc homeostasis and proliferation across multiple cancer types . When comparing results across models, researchers should consider fundamental differences in zinc homeostasis mechanisms between species, cellular transformation status, and tissue-specific contexts. For cross-species comparisons, protein sequence alignment analyses focusing on functional domains and regulatory regions may help explain divergent responses to zinc. Researchers should employ similar methodological approaches when possible across different models to minimize technique-based variations. For seemingly contradictory findings, consider that ZIP11 may have tissue-specific interaction partners or post-translational modifications that alter its function or regulation in different cellular contexts. Comparative subcellular localization studies across cell types can provide insights into functional differences, as the transporter's effects may depend on its predominant localization pattern in a given cell type .

What approaches should be used to distinguish direct ZIP11-mediated effects from secondary consequences of altered zinc homeostasis?

Distinguishing direct ZIP11-mediated effects from secondary consequences of altered zinc homeostasis presents a significant challenge in functional studies . When ZIP11 is knocked down or overexpressed, resulting phenotypes may stem directly from altered ZIP11 activity or indirectly from broad changes in zinc-dependent processes. To differentiate these effects, researchers should include zinc supplementation and chelation controls alongside ZIP11 manipulation . If phenotypes can be rescued by restoring zinc balance without restoring ZIP11 expression, this suggests indirect effects through general zinc dysregulation. Time-course experiments are valuable for establishing causality, as immediate changes following ZIP11 manipulation are more likely to represent direct effects, while later alterations may reflect adaptive or secondary responses. RNA-seq analyses following ZIP11 knockdown have revealed dysregulation of genes involved in angiogenesis, apoptosis, mRNA metabolism, and signaling pathways, particularly Notch signaling . To determine which of these changes are direct consequences of ZIP11 activity, researchers should perform acute inducible knockdown with early timepoint analyses before significant zinc redistribution occurs. Additionally, comparison with phenotypes resulting from other zinc transporter manipulations can help identify ZIP11-specific effects versus general consequences of zinc dysregulation.

How can researchers effectively analyze the complex datasets generated from ZIP11 studies involving transcriptomics, proteomics, and metal analyses?

ZIP11 research generates multidimensional datasets spanning transcriptomics, proteomics, and metal analyses, requiring sophisticated integration approaches . When analyzing RNA-seq data following ZIP11 manipulation, researchers should employ pathway enrichment analyses to identify biological processes affected by ZIP11-mediated zinc dysregulation, as demonstrated in studies showing enrichment of angiogenesis, apoptosis, and signaling pathway genes . For effective integration of metal analysis with gene expression data, researchers can implement correlation networks linking metal concentrations in different cellular compartments with expression changes in zinc-responsive genes. Principal component analysis (PCA) can help identify major patterns of variation across experimental conditions and highlight relationships between metal distribution and cellular phenotypes. For time-course experiments, trajectory analysis methods can reveal the temporal sequence of events following ZIP11 perturbation, helping distinguish primary from secondary effects. When integrating data across multiple omics platforms, researchers should normalize for technical variation using appropriate batch correction methods and employ multi-omics integration tools that account for different data types and scales. Additionally, comparison with publicly available datasets on other zinc transporters can contextualize ZIP11-specific effects within the broader zinc regulatory network.

What are the implications of ZIP11 research for understanding zinc-related pathologies and potential therapeutic interventions?

ZIP11 research has significant implications for understanding zinc-related pathologies, particularly in cancer where ZIP11 expression correlates with poor prognosis in multiple cancer types . Studies have identified ZIP11 gene variants associated with increased risk of renal cell carcinoma and bladder cancer, with four specific variants (rs11871756, rs11077654, rs9913017, and rs4969054) significantly linked to bladder cancer risk . These variants are located within predicted transcribed or enhancer regions, suggesting they may affect ZIP11 expression or regulation. For translational researchers, investigating these variants in patient cohorts could provide valuable biomarkers for cancer risk assessment or prognosis. The observation that ZIP11 knockdown induces senescence in cancer cells points to potential therapeutic strategies targeting this transporter . Researchers exploring therapeutic applications should investigate small molecule inhibitors of ZIP11 transport activity or expression, potentially using high-throughput screening approaches with zinc-responsive reporters in cancer cell lines. Additionally, the interconnection between ZIP11 and the Notch signaling pathway identified through RNA-seq analysis suggests potential synergistic approaches combining ZIP11 targeting with established Notch pathway inhibitors . For gastrointestinal disorders involving zinc dyshomeostasis, ZIP11's high expression in stomach and colon tissues makes it a relevant target for investigation .

How might researchers design novel tools and approaches to further advance ZIP11 research?

Advancing ZIP11 research requires development of specialized tools tailored to its unique properties and cellular roles . Researchers should consider developing ZIP11-specific small molecule modulators (both inhibitors and activators) through targeted drug design or high-throughput screening approaches. Structure-based drug design would benefit from detailed structural information, potentially using homology modeling based on the crystal structure of bacterial ZIP transporters with their unusual 3+2+3TM structure . For cellular zinc imaging, development of subcellular-targeted zinc sensors with improved sensitivity and specificity would enable real-time monitoring of zinc flux between compartments following ZIP11 manipulation. CRISPR-based transcriptional modulation systems (CRISPRa/CRISPRi) would allow titratable control over ZIP11 expression without complete knockout, potentially avoiding compensatory mechanisms that complicate interpretation. For tissue-specific studies, conditional knockout mouse models using the Cre-lox system targeted to specific cell types (e.g., gastric parietal cells or colonic epithelium) would help dissect ZIP11's role in different tissues . Additionally, development of improved antibodies and nanobodies against native ZIP11 epitopes would enhance detection in immunohistochemistry and live-cell imaging applications, overcoming limitations of epitope-tagged overexpression systems .

What collaborative approaches would be most beneficial for comprehensive characterization of ZIP11 biology?

Comprehensive characterization of ZIP11 biology would benefit from multidisciplinary collaborative approaches spanning structural biology, cell physiology, systems biology, and clinical research . Structural biologists could contribute by determining ZIP11's three-dimensional structure through crystallography or cryo-electron microscopy, providing insights into its unique transport mechanism and facilitating structure-based drug design. Collaborations with medical geneticists could investigate the clinical significance of ZIP11 variants identified in cancer patients and their functional consequences . Systems biologists could integrate ZIP11 into broader zinc homeostasis networks through computational modeling, helping predict consequences of ZIP11 perturbation across different tissues and conditions. Developmental biologists focusing on zinc's role in embryogenesis and tissue differentiation could provide valuable insights, as zinc plays critical roles in development and ZIP11's nuclear localization suggests potential involvement in developmental gene regulation . Clinical researchers examining zinc status in patient cohorts with various pathologies could correlate ZIP11 expression or genetic variants with disease states and treatment responses . Additionally, nutritional scientists studying dietary zinc intake and bioavailability could provide physiologically relevant contexts for understanding ZIP11 regulation in response to nutritional zinc status, particularly in gastrointestinal tissues where ZIP11 is highly expressed .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.